KEGG   Homo sapiens (human): 6794Help
Entry
6794              CDS       T01001                                 

Gene name
STK11, LKB1, PJS, hLKB1
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04530  Tight junction
hsa04920  Adipocytokine signaling pathway
Disease
H00019  Pancreatic cancer
H00666  Peutz-Jeghers syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6794 (STK11)
   04151 PI3K-Akt signaling pathway
    6794 (STK11)
   04152 AMPK signaling pathway
    6794 (STK11)
   04150 mTOR signaling pathway
    6794 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6794 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    6794 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    6794 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    6794 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6794 (STK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6794 (STK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   6794 (STK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 6794
NCBI-ProteinID: NP_000446
OMIM: 602216
HGNC: 11389
Ensembl: ENSG00000118046
Vega: OTTHUMG00000180118
Pharos: Q15831(Tchem)
UniProt: Q15831 A0A0S2Z4D1
Structure
PDB: 

Position
19p13.3
AA seq 433 aa AA seqDB search
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggaaattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtgttatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgtggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccagtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcatagccagggcattgtgcacaaggacatcaagccgggg
aacctgctgctcaccaccggtggcaccctcaaaatctccgacctgggcgtggccgaggca
ctgcacccgttcgcggcggacgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtacgaaccggccaagaggttctccatc
cggcagatccggcagcacagctggttccggaagaaacatcctccggctgaagcaccagtg
cccatcccaccgagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggacaggtcccagaagaggaggccagtcacaat
ggacagcgccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctg
agcaccaaatccagggcggagggccgggcccccaaccctgcccgcaaggcctgctccgcc
agcagcaagatccgccggctgtcggcctgcaagcagcagtga

DBGET integrated database retrieval system