KEGG   Homo sapiens (human): 6795Help
Entry
6795              CDS       T01001                                 

Gene name
AURKC, AIE2, AIK3, ARK3, AurC, HEL-S-90, SPGF5, STK13, aurora-C
Definition
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H01282  Spermatogenic failure
Drug target
Ilorasertib: D10423
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6795 (AURKC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6795 (AURKC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6795 (AURKC)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   6795 (AURKC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     6795 (AURKC)
  Sister chromatid separation proteins
   Aurora kinases
    6795 (AURKC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg APH
Motif
Other DBs
NCBI-GeneID: 6795
NCBI-ProteinID: NP_001015878
OMIM: 603495
HGNC: 11391
Ensembl: ENSG00000105146
Vega: OTTHUMG00000183106
Pharos: Q9UQB9(Tchem)
UniProt: Q9UQB9
Structure
PDB: 

Position
19q13.43
AA seq 309 aa AA seqDB search
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccccagagctgtggtgcagctgggcaaagctcaacctgcaggcgaagagttg
gctacagcaaaccaaacagcccagcagcccagcagcccagccatgcggcgcctcacagtc
gatgactttgaaatcgggcgtcccctgggcaaggggaaatttgggaatgtgtacctggct
cggctcaaggaaagccatttcattgtggccctgaaggttctcttcaagtcgcagatagag
aaggaaggactggagcaccagctgcgccgggaaattgagatccaggctcatctacaacac
cccaatatcctgcgcctgtataactatttccatgatgcacgccgggtgtacctgattctg
gaatatgctccaaggggtgagctctacaaggagctgcagaaaagcgagaaattagatgaa
cagcgcacagccacgataatagaggagttggcagatgccctgacctactgccatgacaag
aaagtgattcacagagatattaagccagagaacctgctgctggggttcaggggtgaggtg
aagattgcagattttggctggtctgtgcacaccccctccctgaggaggaagacaatgtgt
gggacactggactacttgccgccagaaatgattgaggggagaacatatgatgaaaaggtg
gatttgtggtgcattggagtgctctgctatgagctgctggtgggatatccaccctttgag
agcgcctcccacagtgagacttacagacgcatcctcaaggtagatgtgaggtttccacta
tcaatgcctctgggggcccgggacttgatttccaggcttctcagataccagcccttggag
agactgcccctggcccagatcctgaagcacccctgggttcaggcccactcccgaagggtg
ctgcctccctgtgctcagatggcttcctga

DBGET integrated database retrieval system