KEGG   Homo sapiens (human): 680Help
Entry
680               CDS       T01001                                 

Gene name
BRS3, BB3, BB3R, BBR3
Definition
(RefSeq) bombesin receptor subtype 3
  KO
K04170  bombesin receptor subtype-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    680 (BRS3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    680 (BRS3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    680 (BRS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx EI24
Motif
Other DBs
NCBI-GeneID: 680
NCBI-ProteinID: NP_001718
OMIM: 300107
HGNC: 1113
Ensembl: ENSG00000102239
Vega: OTTHUMG00000022726
Pharos: P32247(Tchem)
UniProt: P32247
Position
Xq26.3
AA seq 399 aa AA seqDB search
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISV
GILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGC
KVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFAL
PEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLI
ARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQT
YVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADT
SLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaggcagcctcactcacctaatcagactttaatttcaatcacaaatgacaca
gaatcatcaagctctgtggtttctaacgataacacaaataaaggatggagcggggacaac
tctccaggaatagaagcattgtgtgccatctatattacttatgctgtgatcatttcagtg
ggcatccttggaaatgctattctcatcaaagtctttttcaagaccaaatccatgcaaaca
gttccaaatattttcatcaccagcctggcttttggagatcttttacttctgctaacttgt
gtgccagtggatgcaactcactaccttgcagaaggatggctgttcggaagaattggttgt
aaggtgctctctttcatccggctcacttctgttggtgtgtcagtgttcacattaacaatt
ctcagcgctgacagatacaaggcagttgtgaagccacttgagcgacagccctccaatgcc
atcctgaagacttgtgtaaaagctggctgcgtctggatcgtgtctatgatatttgctcta
cctgaggctatattttcaaatgtatacacttttcgagatcccaataaaaatatgacattt
gaatcatgtacctcttatcctgtctctaagaagctcttgcaagaaatacattctctgctg
tgcttcttagtgttctacattattccactctctattatctctgtctactattccttgatt
gctaggaccctttacaaaagcaccctgaacatacctactgaggaacaaagccatgcccgt
aagcagattgaatcccgaaagagaattgccagaacggtattggtgttggtggctctgttt
gccctctgctggttgccaaatcacctcctgtacctctaccattcattcacttctcaaacc
tatgtagacccctctgccatgcatttcattttcaccattttctctcgggttttggctttc
agcaattcttgcgtaaacccctttgctctctactggctgagcaaaagcttccagaagcat
tttaaagctcagttgttctgttgcaaggcggagcggcctgagcctcctgttgctgacacc
tctcttaccaccctggctgtgatgggaacggtcccgggcactgggagcatacagatgtct
gaaattagtgtgacctcgttcactgggtgtagtgtgaagcaggcagaggacagattctag

DBGET integrated database retrieval system