KEGG   Homo sapiens (human): 6804Help
Entry
6804              CDS       T01001                                 

Gene name
STX1A, HPC-1, P35-1, STX1, SYN1A
Definition
(RefSeq) syntaxin 1A
  KO
K04560  syntaxin 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
hsa04911  Insulin secretion
hsa05031  Amphetamine addiction
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6804 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    6804 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6804 (STX1A)
 09160 Human Diseases
  09164 Substance dependence
   05031 Amphetamine addiction
    6804 (STX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6804 (STX1A)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    6804 (STX1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Ferritin RE_NgoFVII Prominin GNVR PspA_IM30 Laminin_II Syntaxin-6_N FAD_binding_1 SIMPL FlgN YtxH ETRAMP DUF1910 Sec34 CorA Med9
Motif
Other DBs
NCBI-GeneID: 6804
NCBI-ProteinID: NP_004594
OMIM: 186590
HGNC: 11433
Ensembl: ENSG00000106089
Vega: OTTHUMG00000137422
Pharos: Q16623(Tbio)
UniProt: Q16623 Q75ME0
Position
7q11.23
AA seq 288 aa AA seqDB search
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgatgatgatgatgtc
gctgtcaccgtggaccgagaccgcttcatggatgagttctttgagcaggtggaggagatt
cgaggcttcattgacaagatcgcagagaacgtggaggaggtgaagcggaagcacagtgcc
atcctggcatcccccaaccccgatgagaagacgaaggaggagctggaagaactcatgtcc
gacataaagaagacagcaaacaaagttcgttccaagttaaagagcatcgagcagtccatc
gagcaagaggaaggcctgaaccgctcctccgctgacctgaggatccggaagacacagcac
tccacgctgtccagaaagtttgtggaggtcatgtcggagtacaacgccacgcagtccgac
taccgcgagcgctgcaaaggccgcatccagaggcagctggagatcaccggcaggaccacg
accagtgaggagctggaggacatgctggagagtgggaaccccgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggctctgagcgagattgagacgcggcacagt
gagatcatcaagctggagaacagcatccgtgagctacacgacatgttcatggacatggcc
atgctcgtggagagccagggagagatgattgacaggatcgagtacaatgtggaacacgcg
gtagactatgtggagagggccgtgtctgacaccaagaaggccgtcaagtaccagagcaag
gcgcgccggaagaaaatcatgatcatcatctgctgtgtgatcctgggcatcgtcatcgcc
tccactgttgggggcatcttcgcctag

DBGET integrated database retrieval system