KEGG   Homo sapiens (human): 6809Help
Entry
6809              CDS       T01001                                 

Gene name
STX3, STX3A
Definition
(RefSeq) syntaxin 3
  KO
K08486  syntaxin 1B/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6809 (STX3)
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    6809 (STX3)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    6809 (STX3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   6809 (STX3)
  Exosomal proteins of other body fluids (saliva and urine)
   6809 (STX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch SIMPL DUF3040 T2SSF Podoplanin
Motif
Other DBs
NCBI-GeneID: 6809
NCBI-ProteinID: NP_004168
OMIM: 600876
HGNC: 11438
Ensembl: ENSG00000166900
Vega: OTTHUMG00000167353
Pharos: Q13277(Tbio)
UniProt: Q13277 Q53YE2
Position
11q12.1
AA seq 289 aa AA seqDB search
MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGLN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccgtctggagcagctgaaggccaagcagctgacacaggatgatgatactgat
gcggttgagattgctatcgacaacacggcttttatggacgagttcttttctgagattgag
gaaactcggcttaacattgacaagatctcagaacatgtagaggaggctaagaaactctac
agtatcattctctctgcaccgattccagagccaaaaaccaaggatgacctagagcagctc
acgactgagattaagaaaagggccaacaacgtccggaacaaactgaagagcatggagaag
catattgaagaagatgaggtcaggtcatcggcagaccttcggattcggaaatcccagcac
tctgtcctttctcggaagtttgtggaggtgatgaccaaatacaatgaagctcaagtggac
ttccgagaacgcagcaaagggcgaatccagcggcagctcgaaattactggcaaaaagaca
accgatgaggagctggaggagatgttggagagtggcaacccggccatcttcacttctggg
atcattgactcacagatttccaagcaagccctcagtgagattgagggacgacacaaggac
attgtgaggctggagagcagcatcaaggagcttcacgacatgtttatggacatcgccatg
ctggtggagaatcagggtgagatgttagataacatagagttgaatgtcatgcacacagtg
gaccacgtggagaaggcacgagatgaaacgaaaaaagctgtgaaataccagagtcaggcc
cggaagaaattgataattatcattgtgctagtagttgtgttgctgggcattttagcattg
attattggactttccgttgggctgaattaa

DBGET integrated database retrieval system