KEGG   Homo sapiens (human): 6819
Entry
6819              CDS       T01001                                 

Gene name
SULT1C2, ST1C1, ST1C2, SULT1C1, humSULTC2
Definition
(RefSeq) sulfotransferase family 1C member 2
  KO
K01025  sulfotransferase [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    6819 (SULT1C2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     6819 (SULT1C2)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Syntaxin
Other DBs
NCBI-GeneID: 6819
NCBI-ProteinID: NP_001047
OMIM: 602385
HGNC: 11456
Ensembl: ENSG00000198203
Vega: OTTHUMG00000153215
Pharos: O00338(Tbio)
UniProt: O00338
Structure
PDB: 
3BFX

Position
2q12.3
AA seq 296 aa
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVD
MIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFW
ENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGW
WEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTN
RSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggccctgacctcagacctggggaaacagataaaactgaaagaggtggaggggaccctc
ctgcagcctgcaactgtggacaactggagccagatccagagcttcgaggccaaaccagat
gatctcctcatctgcacctaccctaaagcagggacaacgtggattcaggaaattgtggat
atgattgaacagaatggggacgtggagaagtgccagcgagccatcatccaacaccgccat
cctttcattgagtgggctcggccaccccaaccttctggtgtggaaaaagccaaagcaatg
ccctctccacggatactaaagactcacctttccactcagctgctgccaccgtctttctgg
gaaaacaactgcaagttcctttatgtagctcgaaatgccaaagactgtatggtttcctac
taccatttccaaaggatgaaccacatgcttcctgaccctggtacctgggaagagtatttt
gaaaccttcatcaatggaaaagtggtttggggttcctggtttgaccacgtgaaaggatgg
tgggagatgaaagacagacaccagattctcttcctcttctatgaggacataaagagggac
ccaaagcatgaaattcggaaggtgatgcagttcatgggaaagaaggtggatgaaacagtg
ctagataaaattgtccaggagacgtcatttgagaaaatgaaagaaaatcccatgacaaat
cgttctacagtttccaaatctatcttggaccagtcaatttcctccttcatgagaaaagga
actgtgggggattggaaaaaccacttcactgttgcccagaatgagaggtttgatgaaatc
tatagaagaaagatggaaggaacctccataaacttctgcatggaactctga

DBGET integrated database retrieval system