KEGG   Homo sapiens (human): 682Help
Entry
682               CDS       T01001                                 

Gene name
BSG, 5F7, CD147, EMMPRIN, EMPRIN, OK, TCSF
Definition
(RefSeq) basigin (Ok blood group)
  KO
K06535  basigin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    682 (BSG)
   04090 CD Molecules [BR:hsa04090]
    682 (BSG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   682 (BSG)
CD molecules [BR:hsa04090]
 Proteins
  682 (BSG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Izumo-Ig
Motif
Other DBs
NCBI-GeneID: 682
NCBI-ProteinID: NP_001719
OMIM: 109480
HGNC: 1116
Ensembl: ENSG00000172270
Vega: OTTHUMG00000177718
Pharos: P35613(Tbio)
UniProt: P35613
Structure
PDB: 

Position
19p13.3
AA seq 385 aa AA seqDB search
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEG
QGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLT
RAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKE
DALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAML
VCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDA
GSAPLKSSGQHQNDKGKNVRQRNSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgctgttcgtgctgctgggattcgcgctgctgggcacccacggagcctcc
ggggctgccggcttcgtccaggcgccgctgtcccagcagaggtgggtggggggcagtgtg
gagctgcactgcgaggccgtgggcagcccggtgcccgagatccagtggtggtttgaaggg
cagggtcccaacgacacctgctcccagctctgggacggcgcccggctggaccgcgtccac
atccacgccacctaccaccagcacgcggccagcaccatctccatcgacacgctcgtggag
gaggacacgggcacttacgagtgccgggccagcaacgacccggatcgcaaccacctgacc
cgggcgcccagggtcaagtgggtccgcgcccaggcagtcgtgctagtcctggaacccggc
acagtcttcactaccgtagaagaccttggctccaagatactcctcacctgctccttgaat
gacagcgccacagaggtcacagggcaccgctggctgaaggggggcgtggtgctgaaggag
gacgcgctgcccggccagaaaacggagttcaaggtggactccgacgaccagtggggagag
tactcctgcgtcttcctccccgagcccatgggcacggccaacatccagctccacgggcct
cccagagtgaaggctgtgaagtcgtcagaacacatcaacgagggggagacggccatgctg
gtctgcaagtcagagtccgtgccacctgtcactgactgggcctggtacaagatcactgac
tctgaggacaaggccctcatgaacggctccgagagcaggttcttcgtgagttcctcgcag
ggccggtcagagctacacattgagaacctgaacatggaggccgaccccggccagtaccgg
tgcaacggcaccagctccaagggctccgaccaggccatcatcacgctccgcgtgcgcagc
cacctggccgccctctggcccttcctgggcatcgtggctgaggtgctggtgctggtcacc
atcatcttcatctacgagaagcgccggaagcccgaggacgtcctggatgatgacgacgcc
ggctctgcacccctgaagagcagcgggcagcaccagaatgacaaaggcaagaacgtccgc
cagaggaactcttcctga

DBGET integrated database retrieval system