KEGG   Homo sapiens (human): 6822Help
Entry
6822              CDS       T01001                                 

Gene name
SULT2A1, DHEA-ST, DHEAS, HST, ST2, ST2A1, ST2A3, STD, hSTa
Definition
(RefSeq) sulfotransferase family 2A member 1
  KO
K11822  bile-salt sulfotransferase [EC:2.8.2.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    6822 (SULT2A1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    6822 (SULT2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    6822 (SULT2A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.14  bile-salt sulfotransferase
     6822 (SULT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Motif
Other DBs
NCBI-GeneID: 6822
NCBI-ProteinID: NP_003158
OMIM: 125263
HGNC: 11458
Ensembl: ENSG00000105398
Vega: OTTHUMG00000162469
Pharos: Q06520(Tbio)
UniProt: Q06520 A8K015
Structure
PDB: 

Position
19q13.33
AA seq 285 aa AA seqDB search
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgatttcttatggtttgaaggcatagctttccctactatgggtttcagatcc
gaaaccttaagaaaagtacgtgatgagttcgtgataagggatgaagatgtaataatattg
acttaccccaaatcaggaacaaactggttggctgagattctctgcctgatgcactccaag
ggggatgccaagtggatccaatctgtgcccatctgggagcgatcaccctgggtagagagt
gagattgggtatacagcactcagtgaaacggagagtccacgtttattctcctcccacctc
cccatccagttattccccaagtctttcttcagttccaaggccaaggtgatttatctcatg
agaaatcccagagatgttttggtgtctggttattttttctggaaaaacatgaagtttatt
aagaaaccaaagtcatgggaagaatattttgaatggttttgtcaaggaactgtgctatat
gggtcatggtttgaccacattcatggctggatgcccatgagagaggagaaaaacttcctg
ttactgagttatgaggagctgaaacaggacacaggaagaaccatagagaagatctgtcaa
ttcctgggaaagacgttagaacccgaagaactgaacttaattctcaagaacagctccttt
cagagcatgaaagaaaacaagatgtccaattattccctcctgagtgttgattatgtagtg
gacaaagcacaacttctgagaaaaggtgtatctggggactggaaaaatcacttcacagtg
gcccaagctgaagactttgataaattgttccaagagaagatggcagatcttcctcgagag
ctgttcccatgggaataa

DBGET integrated database retrieval system