KEGG   Homo sapiens (human): 6829Help
Entry
6829              CDS       T01001                                 

Gene name
SUPT5H, SPT5, SPT5H, Tat-CT1
Definition
(RefSeq) SPT5 homolog, DSIF elongation factor subunit
  KO
K15172  transcription elongation factor SPT5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6829 (SUPT5H)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6829 (SUPT5H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     6829 (SUPT5H)
  RNA polymerase I system
     6829 (SUPT5H)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    DRB sensitivity inducing factor (DSIF) complex
     6829 (SUPT5H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KOW Spt5-NGN Spt5_N DUF3912 DUF150_C Ribonuc_P_40
Motif
Other DBs
NCBI-GeneID: 6829
NCBI-ProteinID: NP_001104490
OMIM: 602102
HGNC: 11469
Ensembl: ENSG00000196235
Vega: OTTHUMG00000182973
Pharos: O00267(Tbio)
UniProt: O00267
Structure
PDB: 

Position
19q13.2
AA seq 1087 aa AA seqDB search
MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEE
EDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRS
GARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLW
TVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIE
GVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQ
NTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLI
FEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKV
IAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELV
QLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIV
KVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVG
GFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGY
IGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGS
GSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQG
SYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSP
GGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSE
KVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRF
LGKLLEA
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagcgaggacagcaacttttccgaggaggaggacagcgagcgcagcagtgac
ggcgaggaggccgaggtagacgaagagcggcggagtgcagcgggcagtgagaaagaagaa
gagcctgaggacgaagaggaggaggaagaggaggaggaatacgatgaggaagaggaggaa
gaagatgatgaccgaccccccaagaaaccccgccatggaggcttcattctggacgaggct
gatgttgacgatgagtatgaggacgaggaccagtgggaggatggagcagaggacattcta
gagaaagaagagattgaagcctccaatatcgataatgttgtcctggatgaagatcgttct
ggggctcgccgcctgcaaaacctctggagggaccagcgagaagaagaactgggcgagtat
tacatgaagaaatacgccaagtcatctgtgggagagacggtgtatggaggatctgatgag
ctctcagacgacatcacccagcagcagctgctcccaggagtcaaggatcccaatctgtgg
actgtcaaatgtaagattggggaggaacgggccacggccatttccttgatgcgcaagttc
attgcctaccagttcacagacacgcccctgcagatcaagtcagtagtggcaccagagcat
gtgaagggctacatctacgtggaggcctacaagcagacccacgtgaagcaggccattgag
ggggtgggcaacctgcggcttggctactggaaccagcagatggtgcccatcaaggagatg
acagacgtgctcaaagtggtgaaggaggtggccaacctgaaaccaaagtcctgggtccgc
ctcaagcggggcatctacaaggatgacattgctcaggtggactacgtggagcccagccag
aacaccatctccctgaagatgatcccacgcatcgactacgatcgcatcaaggcccgcatg
agcttgaaagactggtttgccaaaaggaagaagtttaagcggcctccacagaggctgttt
gatgctgagaagatcaggtccctggggggtgatgttgcctctgatggtgacttcctcatc
tttgaggggaaccgttacagccggaagggctttctgttcaagagcttcgccatgtctgct
gtgatcacggagggtgtgaagccaacactctctgagctggaaaagtttgaggaccagcca
gagggcattgacctggaggtggtgactgagagcacagggaaggagcgggagcacaacttc
caacctggggacaacgtggaggtctgtgagggtgagctcatcaacctgcagggcaagatc
ctcagcgtggatggcaacaagatcaccatcatgcccaagcatgaggacctcaaggacatg
ttggagttcccagcccaggaacttagaaaatacttcaagatgggggaccacgtgaaggtg
attgctggccgattcgagggcgacacaggcctcattgtgcgggtggaggagaatttcgtt
atcctgttctctgacctcaccatgcatgagctgaaggtgctcccccgggacctgcagctc
tgctcagagacagcatcaggtgtggatgttgggggccagcatgaatggggcgagctggtg
cagctggatccccagactgtgggtgtcatcgtgcgactagaacgggagaccttccaggtg
ctgaacatgtacgggaaggtggtgactgtcagacatcaggctgtgacccggaagaaggac
aaccgctttgctgtggccttggactcagagcagaacaacatccatgtgaaagacatcgtt
aaggtcattgatggcccccactcaggccgagaaggggagattcgccatctcttccgaagc
ttcgccttcctacattgcaagaaactggtggagaacgggggcatgtttgtctgcaagacc
cgccacctggtgctggctgggggctcaaagccccgtgatgtgaccaacttcaccgtgggt
ggctttgcgcctatgagtccccggatcagcagccccatgcaccccagtgctggaggtcag
cgtggcggctttggtagcccaggtggcggcagtggtggcatgagcaggggccggggccgg
agggacaacgaactcatcggccagaccgtgcgcatctcccaggggccctacaaaggctac
atcggtgtggtgaaagatgccacagagtccacggcccgtgtggagctgcactccacctgc
cagaccatctctgtggaccgtcagcggctcaccacggtgggctcacggcgcccgggcggc
atgacctcgacctatgggaggacgcccatgtatggctcccagacgcccatgtatggctct
ggctcccgaacacccatgtacggctcacagacacccctccaggatggtagccgcacccca
cactacggctcacagacgcccctgcatgatggcagccgcactcctgcccagagtggggcc
tgggaccccaacaaccccaacacgccgtcacgggctgaggaagaatatgagtatgctttc
gatgatgagcccaccccgtccccgcaggcctatgggggaacccccaatccccaaacacct
ggctacccagacccctcgtccccacaggtcaacccacaatacaacccgcagacgccaggg
acgccggccatgtacaacacagaccagttctctccctatgctgccccctccccacaaggt
tcctaccagcccagccccagcccccagagctaccaccaggtggcgccaagcccagcaggc
taccagaatacccactccccagccagctaccaccctacaccgtcgcccatggcctatcag
gctagccccagcccgagccccgttggctacagtcctatgacacctggagctccctcccct
ggtggctacaacccacacacgccaggctcaggcatcgagcagaactccagcgactgggta
accactgacattcaggtgaaggtgcgggacacctacctggatacacaggtggtgggacag
acaggtgtcatccgcagtgtcacggggggcatgtgctctgtgtacctgaaggacagtgag
aaggttgtcagcatttccagtgagcacctggagcctatcacccccaccaagaacaacaag
gtgaaagtgatcctgggcgaggatcgggaagccacgggcgtcctactgagcattgatggt
gaggatggcattgtccgtatggaccttgatgagcagctcaagatcctcaacctccgcttc
ctggggaagctcctggaagcctga

DBGET integrated database retrieval system