KEGG   Homo sapiens (human): 683Help
Entry
683               CDS       T01001                                 

Gene name
BST1, CD157
Definition
(RefSeq) bone marrow stromal cell antigen 1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa04970  Salivary secretion
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    683 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    683 (BST1)
   04972 Pancreatic secretion
    683 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    683 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    683 (BST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     683 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     683 (BST1)
CD molecules [BR:hsa04090]
 Proteins
  683 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  683 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 683
NCBI-ProteinID: NP_004325
OMIM: 600387
HGNC: 1118
Ensembl: ENSG00000109743
Vega: OTTHUMG00000097739
Pharos: Q10588(Tbio)
UniProt: Q10588
Structure
PDB: 

Position
4p15.32
AA seq 318 aa AA seqDB search
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
DNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ
RAGLIIPLFLVLASRTQL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccaggggtgcgcggcatcgcggctgctccagctgctgctgcagcttctgctt
ctactgttgctgctggcggcgggcggggcgcgcgcgcggtggcgcggggagggcaccagc
gcacacttgcgggacatcttcctgggccgctgcgccgagtaccgcgcactgctgagtccc
gagcagcggaacaagaactgcacagccatctgggaagcctttaaagtggcgctggacaag
gatccctgctccgtgctgccctcagactatgacctttttattaacttgtccaggcactct
attcccagagataagtccctgttctgggaaaatagccacctccttgttaacagctttgca
gacaacacccgtcgttttatgcccctgagcgatgttctgtatggcagggttgcagatttc
ttgagctggtgtcgacagaaaaatgactctggactcgattaccaatcctgccctacatca
gaagactgtgaaaataatcctgtggattccttttggaaaagggcatccatccagtattcc
aaggatagttctggggtgatccacgtcatgctgaatggttcagagccaacaggagcctat
cccatcaaaggtttttttgcagattatgaaattccaaacctccagaaggaaaaaattaca
cgaatcgagatctgggttatgcatgaaattgggggacccaatgtggaatcctgcggggaa
ggcagcatgaaagtcctggaaaagaggctgaaggacatggggttccagtacagctgtatt
aatgattaccgaccagtgaagctcttacagtgcgtggaccacagcacccatcctgactgt
gccttaaagtcggcagcagccgctactcaaagaaaagccccaagtctttatacagaacaa
agggcgggtcttatcattcccctctttctggtgctggcttccaggactcaactgtaa

DBGET integrated database retrieval system