KEGG   Homo sapiens (human): 6843
Entry
6843              CDS       T01001                                 

Gene name
VAMP1, CMS25, SPAX1, SYB1, VAMP-1
Definition
(RefSeq) vesicle associated membrane protein 1
  KO
K08510  vesicle-associated membrane protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Disease
H00770  Congenital myasthenic syndrome
H01351  Spastic ataxia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6843 (VAMP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6843 (VAMP1)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    6843 (VAMP1)
SSDB
Motif
Pfam: Synaptobrevin MCU Orf78 PRIMA1 MgtE DUF2207
Other DBs
NCBI-GeneID: 6843
NCBI-ProteinID: NP_055046
OMIM: 185880
HGNC: 12642
Ensembl: ENSG00000139190
Vega: OTTHUMG00000168269
Pharos: P23763(Tbio)
UniProt: P23763
Position
12p13.31
AA seq 118 aa
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtctgctccagctcagccacctgctgaagggacagaagggactgccccaggtgggggt
ccccctggccctcctcctaacatgaccagtaacagacgactacagcaaacccaggcacaa
gtggaggaggtggtggacatcatacgtgtgaacgtggacaaggtcctggagagggaccag
aagctgtcagagctggatgaccgagctgatgccttgcaggcaggagcatcacaatttgag
agcagtgctgccaagctaaagaggaagtattggtggaaaaactgcaagatgatgatcatg
ctgggagccatctgtgccatcatcgtggtagttattgtaatctacttttttacttga

DBGET integrated database retrieval system