KEGG   Homo sapiens (human): 6845Help
Entry
6845              CDS       T01001                                 

Gene name
VAMP7, SYBL1, TI-VAMP, TIVAMP, VAMP-7
Definition
(RefSeq) vesicle associated membrane protein 7
  KO
K08515  vesicle-associated membrane protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    6845 (VAMP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6845 (VAMP7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6845 (VAMP7)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    6845 (VAMP7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6845 (VAMP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Longin PMT_4TMC
Motif
Other DBs
NCBI-GeneID: 6845
NCBI-ProteinID: NP_005629
OMIM: 300053
HGNC: 11486
Ensembl: ENSG00000124333
Vega: OTTHUMG00000022679
Pharos: P51809(Tbio)
UniProt: P51809 A0A024R061
Structure
PDB: 

Position
Xq28 and Yq12
AA seq 220 aa AA seqDB search
MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgattctttttgctgttgttgccagggggaccactatccttgccaaacatgcttgg
tgtggaggaaacttcctggaggtgacagagcagattctggctaagataccttctgaaaat
aacaaactaacgtactcacatggcaattatttgtttcattacatctgccaagacaggatt
gtatatctttgtatcactgatgatgattttgaacgttcccgagcctttaattttctgaat
gagataaagaagaggttccagactacttacggttcaagagcacagacagcacttccatat
gccatgaatagcgagttctcaagtgtcttagctgcacagctgaagcatcactctgagaat
aagggcctagacaaagtgatggagactcaagcccaagtggatgaactgaaaggaatcatg
gtcagaaacatagatctggtagctcagcgaggagaaagattggaattattgattgacaaa
acagaaaatcttgtggattcttctgtcaccttcaaaactaccagcagaaatcttgctcga
gccatgtgtatgaagaacctcaagctcactattatcatcatcatcgtatcaattgtgttc
atctatatcattgtttcacctctctgtggtggatttacatggccaagctgtgtgaagaaa
tag

DBGET integrated database retrieval system