KEGG   Homo sapiens (human): 685Help
Entry
685               CDS       T01001                                 

Gene name
BTC
Definition
(RefSeq) betacellulin
  KO
K09783  betacellulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    685 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    685 (BTC)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   685 (BTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF Shisa EphA2_TM Cadherin_C_2 TMEM154 Vpu Sigma_reg_N LapA_dom Baculo_11_kDa Rhabdo_glycop TMEM52 DAG1 CD34_antigen YajC DUF3844 DUF2663
Motif
Other DBs
NCBI-GeneID: 685
NCBI-ProteinID: NP_001720
OMIM: 600345
HGNC: 1121
Ensembl: ENSG00000174808
Vega: OTTHUMG00000130107
Pharos: P35070(Tbio)
UniProt: P35070 A0A0S2Z437
Structure
PDB: 

Position
4q13.3
AA seq 178 aa AA seqDB search
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggccgcccggtgcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatccttcactgtgtggtggcagatgggaattccaccagaagtcctgaa
actaatggcctcctctgtggagaccctgaggaaaactgtgcagctaccaccacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcatcaaaggg
agatgccgcttcgtggtggccgagcagacgccctcctgtgtctgtgatgaaggctacatt
ggagcaaggtgtgagagagttgacttgttttacctaagaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggtcatcggtgtctgcaca
tgctgtcaccctcttcggaaacgtcgtaaaagaaagaagaaagaagaagaaatggaaact
ctgggtaaagatataactcctatcaatgaagatattgaagagacaaatattgcttaa

DBGET integrated database retrieval system