KEGG   Homo sapiens (human): 6850Help
Entry
6850              CDS       T01001                                 

Gene name
SYK, p72-Syk
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05152  Tuberculosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00266  EBV LMP2A to PI3K signaling pathway
N00487  BCR-PLCG-Calcineurin signaling pathway
N00488  EBV LMP2A to BCR signaling pathway
Drug target
Fostamatinib (DG01419): D09347 D09348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6850 (SYK)
   04072 Phospholipase D signaling pathway
    6850 (SYK)
   04151 PI3K-Akt signaling pathway
    6850 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6850 (SYK)
   04625 C-type lectin receptor signaling pathway
    6850 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    6850 (SYK)
   04662 B cell receptor signaling pathway
    6850 (SYK)
   04664 Fc epsilon RI signaling pathway
    6850 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    6850 (SYK)
  09158 Development
   04380 Osteoclast differentiation
    6850 (SYK)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    6850 (SYK)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    6850 (SYK)
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    6850 (SYK)
   05169 Epstein-Barr virus infection
    6850 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6850 (SYK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6850 (SYK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SYK family
   6850 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6850
NCBI-ProteinID: NP_001167638
OMIM: 600085
HGNC: 11491
Ensembl: ENSG00000165025
Vega: OTTHUMG00000020200
Pharos: P43405(Tchem)
UniProt: P43405 A0A024R244
Structure
PDB: 

Position
9q22.2
AA seq 635 aa AA seqDB search
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggtggcttcgccctgtccgtggcccacgggaggaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgccggtggcagg
acccatgccagccccgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaac
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagtcctcccctgcccaagggaaccggcaagagagtactgtgtcattc
aatccgtatgagccagaacttgcaccctgggctgcagacaaaggcccccagagagaagcc
ctacccatggacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggccc
aaggaggtttacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcggatgatcgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataagaacatcatagaactggttcatcaggtttccatg
ggcatgaagtacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttacccaacattacgccaagatcagtgatttcggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccggaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaa
gtcaccgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system