KEGG   Homo sapiens (human): 6850Help
Entry
6850              CDS       T01001                                 

Gene name
SYK, p72-Syk
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05152  Tuberculosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00266  EBV LMP2 to host-cell-protein inhibition
Drug target
Fostamatinib (DG01419): D09347 D09348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6850 (SYK)
   04072 Phospholipase D signaling pathway
    6850 (SYK)
   04151 PI3K-Akt signaling pathway
    6850 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6850 (SYK)
   04625 C-type lectin receptor signaling pathway
    6850 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    6850 (SYK)
   04662 B cell receptor signaling pathway
    6850 (SYK)
   04664 Fc epsilon RI signaling pathway
    6850 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    6850 (SYK)
  09158 Development
   04380 Osteoclast differentiation
    6850 (SYK)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    6850 (SYK)
  09167 Infectious diseases
   05152 Tuberculosis
    6850 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6850 (SYK)
   05169 Epstein-Barr virus infection
    6850 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6850 (SYK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6850 (SYK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SYK family
   6850 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 6850
NCBI-ProteinID: NP_001167638
OMIM: 600085
HGNC: 11491
Ensembl: ENSG00000165025
Vega: OTTHUMG00000020200
Pharos: P43405(Tchem)
UniProt: P43405 A0A024R244
Structure
PDB: 

Position
9q22.2
AA seq 635 aa AA seqDB search
MASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPK
PGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREALPMDTEVYESPYADPEEIRP
KEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSM
GMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYA
PECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPRE
MYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcggcatggctgacagcgccaaccacctgcccttctttttcggcaacatc
acccgggaggaggcagaagattacctggtccaggggggcatgagtgatgggctttatttg
ctgcgccagagccgcaactacctgggtggcttcgccctgtccgtggcccacgggaggaag
gcacaccactacaccatcgagcgggagctgaatggcacctacgccatcgccggtggcagg
acccatgccagccccgccgacctctgccactaccactcccaggagtctgatggcctggtc
tgcctcctcaagaagcccttcaaccggccccaaggggtgcagcccaagactgggcccttt
gaggatttgaaggaaaacctcatcagggaatatgtgaagcagacatggaacctgcagggt
caggctctggagcaggccatcatcagtcagaagcctcagctggagaagctgatcgctacc
acagcccatgaaaaaatgccttggttccatggaaaaatctctcgggaagaatctgagcaa
attgtcctgataggatcaaagacaaatggaaagttcctgatccgagccagagacaacaac
ggctcctacgccctgtgcctgctgcacgaagggaaggtgctgcactatcgcatcgacaaa
gacaagacagggaagctctccatccccgagggaaagaagttcgacacgctctggcagcta
gtcgagcattattcttataaagcagatggtttgttaagagttcttactgtcccatgtcaa
aaaatcggcacacagggaaatgttaattttggaggccgtccacaacttccaggttcccat
cctgcgacttggtcagcgggtggaataatctcaagaatcaaatcatactccttcccaaag
cctggccacagaaagtcctcccctgcccaagggaaccggcaagagagtactgtgtcattc
aatccgtatgagccagaacttgcaccctgggctgcagacaaaggcccccagagagaagcc
ctacccatggacacagaggtgtacgagagcccctacgcggaccccgaggagatcaggccc
aaggaggtttacctggaccgaaagctgctgacgctggaagacaaagaactgggctctggt
aattttggaactgtgaaaaagggctactaccaaatgaaaaaagttgtgaaaaccgtggct
gtgaaaatactgaaaaacgaggccaatgaccccgctcttaaagatgagttattagcagaa
gcaaatgtcatgcagcagctggacaacccgtacatcgtgcggatgatcgggatatgcgag
gccgagtcctggatgctggttatggagatggcagaacttggtcccctcaataagtatttg
cagcagaacagacatgtcaaggataagaacatcatagaactggttcatcaggtttccatg
ggcatgaagtacttggaggagagcaattttgtgcacagagatctggctgcaagaaatgtg
ttgctagttacccaacattacgccaagatcagtgatttcggactttccaaagcactgcgt
gctgatgaaaactactacaaggcccagacccatggaaagtggcctgtcaagtggtacgct
ccggaatgcatcaactactacaagttctccagcaaaagcgatgtctggagctttggagtg
ttgatgtgggaagcattctcctatgggcagaagccatatcgagggatgaaaggaagtgaa
gtcaccgctatgttagagaaaggagagcggatggggtgccctgcagggtgtccaagagag
atgtacgatctcatgaatctgtgctggacatacgatgtggaaaacaggcccggattcgca
gcagtggaactgcggctgcgcaattactactatgacgtggtgaactaa

DBGET integrated database retrieval system