KEGG   Homo sapiens (human): 6855Help
Entry
6855              CDS       T01001                                 

Gene name
SYP, MRX96, MRXSYP
Definition
(RefSeq) synaptophysin
Organism
hsa  Homo sapiens (human)
Disease
H00480  X-linked mental retardation
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL DUF588
Motif
Other DBs
NCBI-GeneID: 6855
NCBI-ProteinID: NP_003170
OMIM: 313475
HGNC: 11506
Ensembl: ENSG00000102003
Vega: OTTHUMG00000034557
Pharos: P08247(Tbio)
UniProt: P08247
Position
Xp11.23
AA seq 313 aa AA seqDB search
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANK
TESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMG
ALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEM
PVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAP
EKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGY
GPQGAPTSFSNQM
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctggcggacatggacgtggtgaatcagctggtggctgggggtcagttccgg
gtggtcaaggagcccctcggctttgtgaaggtgctgcaatgggtcttcgccatcttcgcc
tttgccacatgcggcagctacagtggggagctccagctgagcgtggattgtgccaacaag
accgagagtgacctcagcatcgaggtcgagttcgagtaccccttcaggctgcaccaagtg
tactttgatgcacccacctgccgagggggcaccaccaaggtcttcttagttggggactac
tcctcgtcagccgaattctttgtcaccgtggccgtgtttgccttcctctactccatgggg
gctctggccacctacatcttcctgcagaacaagtaccgagagaataacaaagggcccatg
ctggactttctggccacggctgtgttcgccttcatgtggctagttagctcatcggcatgg
gccaaggggctgtcagatgtgaagatggccacagacccagagaacattatcaaggagatg
cctgtctgccgccagacagggaacacatgcaaggagctgagagaccctgtgacctcggga
ctcaacacctcggtggtgttcggcttcctgaacctggtgctctgggtcggcaacctgtgg
ttcgtgtttaaggagacaggctgggccgccccgttcctgcgcgcgcctcccggcgccccc
gagaaacaaccggcacccggggacgcctacggcgatgcaggctacgggcagggccccggc
gggtacgggccccaggattcctacgggcctcagggcggctaccagcctgactatggtcaa
ccagccggcagcggtggcagtggctacgggcctcagggcgactatgggcagcaaggctac
ggcccgcagggtgcacccacctccttctccaatcagatgtag

DBGET integrated database retrieval system