KEGG   Homo sapiens (human): 6869Help
Entry
6869              CDS       T01001                                 

Gene name
TACR1, NK1R, NKIR, SPR, TAC1R
Definition
(RefSeq) tachykinin receptor 1
  KO
K04222  tachykinin receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05162  Measles
Drug target
Aprepitant (DG00066): D02968 D06597 D10895
Befetupitant: D03221
Casopitant: D06574
Ezlopitant: D04122
Maropitant citrate: D04860
Netupitant (DG02843): D05152 D11065
Orvepitant (DG01315): D09650 D09651
Rolapitant (DG01868): D08988 D10742
Serlopitant: D09378
Telmapitant: D10391
Vestipitant mesylate: D06293
Vofopitant dihydrochloride: D06317
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    6869 (TACR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6869 (TACR1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05162 Measles
    6869 (TACR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6869 (TACR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Tachykinin
    6869 (TACR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 TctB
Motif
Other DBs
NCBI-GeneID: 6869
NCBI-ProteinID: NP_001049
OMIM: 162323
HGNC: 11526
Ensembl: ENSG00000115353
Vega: OTTHUMG00000129973
Pharos: P25103(Tclin)
UniProt: P25103
Structure
PDB: 

Position
2p12
AA seq 407 aa AA seqDB search
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggataacgtcctcccggtggactcagacctctccccaaacatctccactaacacctcg
gaacccaatcagttcgtgcaaccagcctggcaaattgtcctttgggcagctgcctacacg
gtcattgtggtgacctctgtggtgggcaacgtggtagtgatgtggatcatcttagcccac
aaaagaatgaggacagtgacgaactattttctggtgaacctggccttcgcggaggcctcc
atggctgcattcaatacagtggtgaacttcacctatgctgtccacaacgaatggtactac
ggcctgttctactgcaagttccacaacttctttcccatcgccgctgtcttcgccagtatc
tactccatgacggctgtggcctttgataggtacatggccatcatacatcccctccagccc
cggctgtcagccacagccaccaaagtggtcatctgtgtcatctgggtcctggctctcctg
ctggccttcccccagggctactactcaaccacagagaccatgcccagcagagtcgtgtgc
atgatcgaatggccagagcatccgaacaagatttatgagaaagtgtaccacatctgtgtg
actgtgctgatctacttcctccccctgctggtgattggctatgcatacaccgtagtggga
atcacactatgggccagtgagatccccggggactcctctgaccgctaccacgagcaagtc
tctgccaagcgcaaggtggtcaaaatgatgattgtcgtggtgtgcaccttcgccatctgc
tggctgcccttccacatcttcttcctcctgccctacatcaacccagatctctacctgaag
aagtttatccagcaggtctacctggccatcatgtggctggccatgagctccaccatgtac
aaccccatcatctactgctgcctcaatgacaggttccgtctgggcttcaagcatgccttc
cggtgctgccccttcatcagcgccggcgactatgaggggctggaaatgaaatccacccgg
tatctccagacccagggcagtgtgtacaaagtcagccgcctggagaccaccatctccaca
gtggtgggggcccacgaggaggagccagaggacggccccaaggccacaccctcgtccctg
gacctgacctccaactgctcttcacgaagtgactccaagaccatgacagagagcttcagc
ttctcctccaatgtgctctcctag

DBGET integrated database retrieval system