KEGG   Homo sapiens (human): 6870Help
Entry
6870              CDS       T01001                                 

Gene name
TACR3, HH11, NK-3R, NK3, NK3R, NKR, TAC3R, TAC3RL
Definition
(RefSeq) tachykinin receptor 3
  KO
K04224  tachykinin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00255  Hypogonadotropic hypogonadism
Drug target
Talnetant hydrochloride: D05996
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    6870 (TACR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6870 (TACR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    6870 (TACR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Tachykinin [OT]
    6870 (TACR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 6870
NCBI-ProteinID: NP_001050
OMIM: 162332
HGNC: 11528
Ensembl: ENSG00000169836
Vega: OTTHUMG00000131124
Pharos: P29371(Tchem)
UniProt: P29371
Position
4q24
AA seq 465 aa AA seqDB search
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccactctcccagcagcagaaacctggatagacgggggtggaggcgtgggtgcagac
gccgtgaacctgaccgcctcgctagctgccggggcggccacgggggcagttgagactggg
tggctgcaactgctggaccaagctggcaacctctcctcctccccttccgcgctgggactg
cctgtggcttcccccgcgccctcccagccctgggccaacctcaccaaccagttcgtgcag
ccgtcctggcgcatcgcgctctggtccctggcgtatggtgtggtggtggcagtggcagtt
ttgggaaatctcatcgtcatctggatcatcctggcccacaagcgcatgaggactgtcacc
aactacttccttgtgaacctggctttctccgacgcctccatggccgccttcaacacgttg
gtcaatttcatctacgcgcttcatagcgagtggtactttggcgccaactactgccgcttc
cagaacttctttcctatcacagctgtgttcgccagcatctactccatgacggccattgcg
gtggacaggtatatggctattattgatcccttgaaacccagactgtctgctacagcaacc
aagattgtcattggaagtatttggattctagcatttctacttgccttccctcagtgtctt
tattccaaaaccaaagtcatgccaggccgtactctctgctttgtgcaatggccagaaggt
cccaaacaacatttcacttaccatattatcgtcattatactggtgtactgtttcccattg
ctcatcatgggtattacatacaccattgttggaattactctctggggaggagaaatccca
ggagatacctgtgacaagtatcatgagcagctaaaggccaaaagaaaggttgtcaaaatg
atgattattgttgtcatgacatttgctatctgctggctgccctatcatatttacttcatt
ctcactgcaatctatcaacaactaaatagatggaaatacatccagcaggtctacctggct
agcttttggctggcaatgagctcaaccatgtacaatcccatcatctactgctgtctgaat
aaaagatttcgagctggcttcaagagagcatttcgctggtgtcctttcatcaaagtttcc
agctatgatgagctagagctcaagaccaccaggtttcatccaaaccggcaaagcagtatg
tacaccgtgaccagaatggagtccatgacagtcgtgtttgaccccaacgatgcagacacc
accaggtccagtcggaagaaaagagcaacgccaagagacccaagtttcaatggctgctct
cgcaggaattccaaatctgcctccgccacttcaagtttcataagctcaccctatacctct
gtggatgaatattcttaa

DBGET integrated database retrieval system