KEGG   Homo sapiens (human): 6873
Entry
6873              CDS       T01001                                 
Symbol
TAF2, CIF150, MRT40, TAF2B, TAFII150
Name
(RefSeq) TATA-box binding protein associated factor 2
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Disease
H00768  Autosomal recessive intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6873 (TAF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6873 (TAF2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6873 (TAF2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6873 (TAF2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   6873 (TAF2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6873 (TAF2)
   Coactivators
    SAGA/TFTC/STAGA complex
     6873 (TAF2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6873 (TAF2)
SSDB
Motif
Pfam: Peptidase_M1_N HEAT_2 Peptidase_M1 SR-25
Other DBs
NCBI-GeneID: 6873
NCBI-ProteinID: NP_003175
OMIM: 604912
HGNC: 11536
Ensembl: ENSG00000064313
UniProt: Q6P1X5 B3KMD8
Position
8:complement(119730774..119832841)
AA seq 1199 aa
MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFIS
RMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGG
GKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRK
RNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVV
AQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIK
YNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNME
KLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEA
ANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPAS
SRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTA
SKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD
NT seq 3600 nt   +upstreamnt  +downstreamnt
atgccgctgactggtgtagagcccgccagaatgaacaggaagaaaggagacaagggcttt
gaaagcccaaggccatataaattaacccatcaggtcgtctgcatcaacaacataaatttc
cagagaaaatctgttgtgggatttgtggaactgactatatttcccacagttgcaaacttg
aatagaatcaagttgaacagcaaacagtgtagaatataccgagtaaggatcaatgattta
gaggctgcttttatttataatgacccaaccttggaagtttgtcacagtgaatcaaaacag
agaaacctcaattatttttccaatgcttatgcagctgcagttagtgctgtggaccctgat
gcaggaaatggagaactttgcattaaggttccatcagagctatggaaacacgttgatgag
ttaaaggtcctgaagatacacatcaatttttctttggatcagcccaaaggaggtcttcat
tttgtggtacccagtgtagagggaagtatggcagagagaggtgctcatgttttctcttgt
gggtatcaaaattctacaagattttggttcccttgtgttgattcatactctgaattgtgt
acatggaaattagaatttacagtagatgctgcaatggttgctgtttctaatggcgatttg
gtggagacagtgtatactcatgatatgaggaagaaaactttccattatatgcttaccatt
cctacagcagcgtcaaatatctccttggccattggaccatttgaaatactggtagatcca
tacatgcatgaggttactcatttttgtttgccccaacttcttccattgctgaaacatacc
acatcataccttcatgaagtctttgaattttatgaagaaattcttacatgtcgttaccca
tactcctgttttaagactgtcttcattgatgaggcttatgttgaagtggctgcttatgct
tccatgagcatttttagcacaaatcttttacacagtgccatgattatagatgagacacct
ttgactagaaggtgtttagcccaatccttggcccagcagttttttggttgtttcatatct
agaatgtcttggtctgatgaatgggtgctgaagggaatttcaggctatatctatggactt
tggatgaaaaaaacttttggtgttaatgagtaccgccattggattaaagaggagctagac
aaaatagtggcatatgaactaaaaactggtggggttttactacatcccatatttggtgga
ggaaaagagaaggataatccggcttcccatctacacttttcaataaagcatccacataca
ctgtcctgggaatactacagtatgtttcagtgtaaagcccaccttgtgatgagattgatt
gaaaataggatcagtatggaatttatgctacaagttttcaataaactgctaagtctggct
agtactgcttcatctcagaagttccagtcacatatgtggagtcagatgttggtttccaca
tctgggtttttgaaatccatttcaaatgtctctggcaaagatattcagccgttaataaag
cagtgggtagatcagagtggagtggtaaaattttatggaagttttgcatttaatagaaaa
cgaaatgtcttggaactggaaataaaacaggactatacatctcctggaactcagaaatac
gtgggaccacttaaagtgacagtgcaggagttagatggatccttcaatcatacactgcaa
attgaagaaaacagccttaaacatgatataccctgccattccaaaagtagaaggaataaa
aagaaaaaaatcccactgatgaatggagaagaagttgatatggatctttctgcaatggat
gctgattcccctttgctgtggataaggatagacccagatatgtcagtattgaggaaggta
gaatttgagcaagctgattttatgtggcagtatcagctccgctatgagagagatgttgtt
gcacagcaggaatccattttggctttggaaaaattccctactccagcatctcggcttgca
ctcactgatatattagaacaagagcagtgtttctacagagtaagaatgtcagcttgcttc
tgtcttgcaaagattgcaaattcaatggtgagcacatggacaggaccaccagccatgaag
tcactcttcactaggatgttttgttgtaaaagttgtccaaacattgtgaaaacaaacaac
tttatgagctttcaaagctattttctacagaagactatgccagttgcaatggctttatta
agagatgttcataatctttgtcctaaagaagtcttaacatttattttagacttaatcaag
tacaatgacaacaggaaaaataagttttcagataactattatcgtgcagaaatgattgat
gccctggccaactctgttacacctgcagtcagtgtgaataatgaagttagaactttggat
aacttaaatcctgatgtgcgactcattcttgaagaaatcaccagatttttgaatatggaa
aaacttcttccgagttacaggcataccatcactgtcagttgtttgagagccatacgggta
cttcagaagaacggacatgtgccaagtgatccagctctttttaaatcttatgctgaatat
ggccactttgtggacattaggatagcagctttggaagcagttgttgattatactaaagtg
gacagaagttatgaagaactgcaatggctacttaatatgattcagaatgaccctgtaccc
tatgtaaggcataagattctcaacatgttgactaagaacccaccatttactaagaacatg
gagtctcccttatgcaatgaagccctggtagatcaactttggaaacttatgaattctggt
acttcacatgactggaggttacggtgtggtgctgtggacttgtacttcacactttttggc
ctcagtagaccttcctgtttacccttgccagagcttgggttggttcttaatctaaaggag
aaaaaagctgtcttgaatcctaccataattccagagtcagtagcaggcaaccaagaagct
gcaaataatccaagcagtcacccacagctagttggatttcagaaccctttttccagttct
caagatgaggaggagattgatatggatactgttcatgatagccaggccttcatttcccat
catttaaacatgcttgaaaggccgtcaactccagggctctcgaaatatcggccagctagc
tcccgatctgctttaataccccagcactcagcaggctgtgacagcacacccaccacaaaa
ccccagtggagtttggaacttgcacggaagggaacaggtaaagaacaagcacctttggag
atgagtatgcatccagcggcaagcgctccactctcagtctttactaaggaatctacagcc
tccaaacacagtgaccaccatcaccaccatcaccatgagcacaagaaaaagaagaagaag
cataaacataagcacaaacacaagcataagcatgacagtaaagaaaaggacaaggagcct
ttcactttctccagccctgccagtggcaggtctattcgttctccttccctttcagactga

DBGET integrated database retrieval system