KEGG   Homo sapiens (human): 6874Help
Entry
6874              CDS       T01001                                 

Gene name
TAF4, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135
Definition
(RefSeq) TATA-box binding protein associated factor 4
  KO
K03129  transcription initiation factor TFIID subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05016  Huntington disease
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6874 (TAF4)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    6874 (TAF4)
  09167 Infectious diseases
   05168 Herpes simplex infection
    6874 (TAF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6874 (TAF4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6874 (TAF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6874 (TAF4)
   Coactivators
    SAGA/TFTC/STAGA complex
     6874 (TAF4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6874 (TAF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TAF4 TAFH tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 6874
NCBI-ProteinID: NP_003176
OMIM: 601796
HGNC: 11537
Ensembl: ENSG00000130699
Vega: OTTHUMG00000032893
Pharos: O00268(Tbio)
UniProt: O00268
Structure
PDB: 

Position
20q13.33
AA seq 1085 aa AA seqDB search
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGN
HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPA
PPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGP
GPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPP
AAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQT
LAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATT
SGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATL
QRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFL
STLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRS
LPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTP
QQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASM
AGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVS
YVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKV
DCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLY
KAFLK
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgggctcggatctgctggacgaggtcttcttcaacagcgaggtggacgagaaa
gtggtgagcgacctggtgggctcgctggagtcgcagctggcggccagcgcggcccaccac
caccacctcgcgccgcgcacgcccgaggtgcgggccgcggccgccggcgcgctcgggaac
catgttgtgagcggcagcccggccggagccgcgggcgcagggccggccgcccccgccgag
ggcgcgcccggagcggcgccggagccgccccccgcaggtagagcgcggccggggggcggg
gggccgcagcgcccgggccccccctcaccgcgccgcccccttgtccccgcagggcccgcg
ccgcccgccgcgaagctgaggccgccgcccgagggcagcgcggggtcctgcgccccggtg
cccgccgccgccgccgtcgccgcggggcccgagcccgcccccgccggccccgccaagccc
gccggccccgccgcgctggccgcccgcgccggccccggccccgggcccggccccggcccc
ggccccggccctggccctggcaagcccgccggccccggcgccgcgcaaactttgaatggg
agcgccgcgctgctgaactcgcaccacgccgccgcacctgctgtcagcctggtcaacaac
gggcccgccgcgctgctgccgctgcccaagcccgccgcccccggcactgtcatccagacg
ccccccttcgtgggcgccgccgcgccccccgcgcccgccgcgccctcgccccccgccgcc
cccgcgcccgccgcccccgccgccgccccgcccccgccaccccccgcgcccgccactctg
gcccggccgcccggccaccccgccggacccccgaccgccgcgcccgccgtgccgcccccc
gccgccgcccagaacgggggcagcgccggggcagcccccgcccccgccccggccgccggg
ggccccgcgggggtcagcggccaacccgggcccggcgcggcggctgcggcgccggcgccg
ggggtcaaggccgagtcgcccaagagggtggtgcaggcggcgcccccggcggcgcagacc
ctggcggccagcggcccggccagcacggcggccagcatggtcatcgggccaactatgcaa
ggggcgctgcccagcccggccgccgtcccgccgcccgcccccgggacccccaccgggctg
cccaaaggcgcggccggcgcagtgacccagagcctgtcccggacgcccacggccaccacc
agcgggattcgggccaccctgacgcccaccgtgctggccccccgcttgccgcagccgcct
cagaacccgaccaacatccagaacttccagctgcccccaggaatggtcctcgtccgaagt
gagaatgggcagttgttaatgattcctcagcaggccttggcccagatgcaggcgcaggcc
catgcccagcctcagaccaccatggcgcctcgccctgccacccccacaagtgcccctccc
gtccagatctccaccgtacaggcacctggaacacctatcattgcacggcaggtgacccca
actaccataattaagcaagtgtctcaggcccagacaacggtgcagcccagtgcaaccctg
cagcgctcgcccggcgtccagcctcagctcgttctgggtggcgctgcccagacggcttca
cttgggacggcgacggctgttcagacggggactcctcagcgcacggtaccaggggcgacc
accacttcctcagctgccacggaaactatggaaaacgtgaagaaatgtaaaaatttccta
tctacgttaataaaactggcttcatctggcaagcagtctacagagacagcagctaatgtg
aaagagctcgtgcagaatttactggatggaaaaatagaagcagaagatttcacaagcagg
ttataccgagaacttaattcttcacctcaaccttaccttgtgcctttcctgaagaggagc
ttacccgccttgagacagctgacccccgactccgcggccttcatccagcagagccagcag
cagccgccaccgcccacctcgcaggccaccactgcgctcacggccgtggtgctgagtagc
tcggtccagcgcacggccgggaagacggcggccaccgtgaccagtgccctccagccccct
gtgctcagcctcacgcagcccacgcaggtcggcgtcggcaagcaggggcaacccacaccg
ctggtcatccagcagcctccgaagccaggagccctgatccggcccccgcaggtgacgttg
acgcagacacccatggtcgccctgcggcagcctcacaaccggatcatgctcaccacgcct
cagcagatccagctgaacccactgcagccagtccctgtggtgaaacccgccgtgttacct
ggaaccaaagccctttctgctgtctcggcacaagcagctgctgcacagaaaaataaactc
aaggagcctgggggaggttcgtttcgggacgatgatgacattaatgatgttgcatcgatg
gctggagtaaacttgtcagaagaaagtgcaagaatattagccacgaactctgaattggtg
ggcacgctaacgcggtcctgtaaagatgaaaccttcctcctccaagcgcctttgcagaga
agaatattagaaataggtaaaaaacatggtataacggaattacatccagatgtagtaagt
tatgtatcacatgccacgcaacaaaggctacagaatcttgtagagaaaatatcagaaaca
gctcagcagaagaacttttcttacaaggatgacgacagatatgagcaggcgagtgacgtc
cgggcacagctcaagttttttgaacagcttgatcaaatcgaaaagcagaggaaggatgag
caggagcgggagatcctgatgagggcagcaaagtctcggtcaagacaagaagatccagaa
cagttaaggctgaaacagaaggcaaaggagatgcagcaacaggaactggcacaaatgaga
cagcgggacgccaacctcacagcactagcagcgatcgggcccaggaaaaagaggaaagtg
gactgtccggggccgggctcaggagcagaggggtcgggccccggctcagtggtcccaggc
agctcgggtgtcggaacccccagacagttcacgcgacaaagaatcacgcgggtcaacctc
agggacctcatattttgtttagaaaatgaacgtgagacaagccattcactgctgctctac
aaagcattccttaagtga

DBGET integrated database retrieval system