KEGG   Homo sapiens (human): 6877Help
Entry
6877              CDS       T01001                                 

Gene name
TAF5, TAF(II)100, TAF2D, TAFII-100, TAFII100
Definition
(RefSeq) TATA-box binding protein associated factor 5
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6877 (TAF5)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    6877 (TAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6877 (TAF5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6877 (TAF5)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6877 (TAF5)
   Coactivators
    SAGA/TFTC/STAGA complex
     6877 (TAF5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     6877 (TAF5)
    STAGA complex
     6877 (TAF5)
    TFTC complex
     6877 (TAF5)
    SAGA complex
     6877 (TAF5)
    SLIK complex
     6877 (TAF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Nup160 Ge1_WD40 RAB3GAP2_N Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 6877
NCBI-ProteinID: NP_008882
OMIM: 601787
HGNC: 11539
Ensembl: ENSG00000148835
Vega: OTTHUMG00000018985
Pharos: Q15542(Tbio)
UniProt: Q15542
Structure
PDB: 

Position
10q24.33
AA seq 800 aa AA seqDB search
MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGD
GGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREA
GLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASG
PAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
RTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLA
GEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPN
APPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILY
GHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYF
VSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGN
CVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS
RDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPV
VHLHFTRRNLVLAAGAYSPQ
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggcggaggagcagacggaggtggcggtcaagctagagcctgagggaccg
ccaacgctgctacctccgcaggcgggggacggcgcaggcgagggtagcggcggcactacc
aacaacggccccaacggcggcggcgggaacgttgcggcgtcgtcgtccactggcggggat
ggcgggacccccaagcccacggtggctgtctccgccgctgccccggcgggggcggccccg
gtgcccgccgctgctccggacgccggcgctccgcatgaccgacagactctactggccgtg
ctgcagttcctacggcagagcaaactccgcgaggccgaagaggcgctgcgccgtgaggcc
gggctgctggaggaggcagtggcgggctccggagccccgggagaggtggacagcgccggc
gctgaggtgaccagcgcgcttctcagccgggtgaccgcctcggcccctggccctgcggcc
cccgaccctccgggcactggcgcttcgggggccacggtcgtctcaggttcagcctcaggt
cctgcggctccgggtaaagttggaagtgttgctgtggaagaccagccagatgtcagtgcc
gtgttgtcagcctacaaccaacaaggagatcccacaatgtatgaagaatactatagtgga
ctgaaacacttcattgaatgttccctggactgccatcgggcagagttgtcccaacttttt
tatcctctgtttgtgcacatgtacttggagctagtctacaatcaacatgagaatgaagca
aagtcattctttgagaagttccatggagatcaggaatgttattaccaggatgacctacga
gtattatctagtcttaccaaaaaggaacacatgaaagggaatgagaccatgttggatttt
cgaacaagtaaatttgttctgcgtatttcccgtgactcgtaccaactcttgaagaggcat
cttcaggagaaacagaacaatcagatatggaacatagttcaggagcacctctacattgac
atctttgatgggatgccgcgtagtaagcaacagatagatgcgatggtgggaagtttggca
ggagaggctaaacgagaggcaaacaaatcaaaggtattttttggtttattaaaagaacca
gaaattgaggtacctttggatgacgaggatgaagagggagaaaatgaagaaggaaaacct
aaaaagaagaagcctaaaaaagatagtattggatccaaaagcaaaaaacaagatcccaat
gctccacctcagaacagaatccctcttcctgagttgaaagattcagataagttggataag
ataatgaatatgaaagaaaccaccaaacgagtgcgccttgggccggactgcttaccctcc
atttgtttctatacatttctcaatgcttaccagggtctcactgcagtggatgtcactgat
gattctagtctgattgctggaggttttgcagattcaactgtcagagtgtggtcggtaaca
cccaaaaagcttcgtagtgtcaaacaagcatcagatcttagtcttatagacaaagaatca
gatgatgtcttagaaagaatcatggatgagaaaacagcaagtgagttgaagattttgtat
ggtcacagtgggcctgtctacggagccagcttcagtccggataggaactatctgctttcc
tcttcagaggacggaactgttagattgtggagccttcaaacatttacttgtttggtggga
tataaaggacacaactatccagtatgggacacacaattttctccatatggatattatttt
gtgtcagggggccatgaccgagtagctcggctctgggctacagaccactatcagccttta
agaatatttgccggccatcttgctgatgtgaattgtaccagattccatccaaattctaat
tatgttgctacgggctctgcagacagaactgtgcggctctgggacgtcctgaatggtaac
tgtgtaaggatcttcactggacacaagggaccaattcattccttgacattttctcccaat
gggagattcctggctacaggagcaacagatggcagagtgcttctttgggatattggacat
ggtttgatggttggagaattaaaaggccacactgatacagtctgttcacttaggtttagt
agagatggtgaaattttggcatcaggttcaatggataatacagttcgattatgggatgct
atcaaagcctttgaagatttagagaccgatgactttactacagccactgggcatataaat
ttacctgagaattcacaggagttattgttgggaacatatatgaccaaatcaacaccagtt
gtacaccttcattttactcgaagaaacctggttctagctgcaggagcttatagtccacaa
taa

DBGET integrated database retrieval system