KEGG   Homo sapiens (human): 6888
Entry
6888              CDS       T01001                                 

Gene name
TALDO1, TAL, TAL-H, TALDOR, TALH
Definition
(RefSeq) transaldolase 1
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hsa_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Disease
H01189  Transaldolase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6888 (TALDO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     6888 (TALDO1)
SSDB
Motif
Pfam: TAL_FSA
Other DBs
NCBI-GeneID: 6888
NCBI-ProteinID: NP_006746
OMIM: 602063
HGNC: 11559
Ensembl: ENSG00000177156
Vega: OTTHUMG00000133318
Pharos: P37837(Tbio)
UniProt: P37837 A0A140VK56
Structure
PDB: 
1F05

Position
11p15.5
AA seq 337 aa
MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQE
LVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVA
RARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAE
AGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRN
TGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNE
DQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtcgagctcacccgtgaagcgtcagaggatggagtccgcgctggaccagctcaagcag
ttcaccaccgtggtggccgacacgggcgacttccacgccatcgacgagtacaagccccag
gatgctaccaccaacccgtccctgatcctggccgcagcacagatgcccgcttaccaggag
ctggtggaggaggcgattgcctatggccggaagctgggcgggtcacaagaggaccagatt
aaaaatgctattgataaactttttgtgttgtttggagcagaaatactaaagaagattccg
ggccgagtatccacagaagtagacgcaaggctctcctttgataaagatgcgatggtggcc
agagccaggcggctcatcgagctctacaaggaagctgggatcagcaaggaccgaattctt
ataaagctgtcatcaacctgggaaggaattcaggctggaaaggagctcgaggagcagcac
ggcatccactgcaacatgacgttactcttctccttcgcccaggctgtggcctgtgccgag
gcgggtgtgaccctcatctccccatttgttgggcgcatccttgattggcatgtggcaaac
accgacaagaaatcctatgagcccctggaagaccctggggtaaagagtgtcactaaaatc
tacaactactacaagaagtttagctacaaaaccattgtcatgggcgcctccttccgcaac
acgggcgagatcaaagcactggccggctgtgacttcctcaccatctcacccaagctcctg
ggagagctgctgcaggacaacgccaagctggtgcctgtgctctcagccaaggcggcccaa
gccagtgacctggaaaaaatccacctggatgagaagtctttccgttggttgcacaacgag
gaccagatggctgtggagaagctctctgacgggatccgcaagtttgccgctgatgcagtg
aagctggagcggatgctgacagaacgaatgttcaatgcagagaatggaaagtag

DBGET integrated database retrieval system