KEGG   Homo sapiens (human): 6891Help
Entry
6891              CDS       T01001                                 

Gene name
TAP2, ABC18, ABCB3, APT2, D6S217E, PSF-2, PSF2, RING11
Definition
(RefSeq) transporter 2, ATP binding cassette subfamily B member
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex infection
hsa05340  Primary immunodeficiency
Network
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
Disease
H00093  Combined immunodeficiencies (CIDs)
H00984  Bare lymphocyte syndrome (BLS) type1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    6891 (TAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    6891 (TAP2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    6891 (TAP2)
 09160 Human Diseases
  09162 Immune diseases
   05340 Primary immunodeficiency
    6891 (TAP2)
  09167 Infectious diseases
   05168 Herpes simplex infection
    6891 (TAP2)
   05163 Human cytomegalovirus infection
    6891 (TAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6891 (TAP2)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    6891 (TAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_30 AAA_29 AAA_22 AAA_16 AAA_25 AAA_21 AAA_15 AAA_23 AAA_33 SRP54 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 6891
NCBI-ProteinID: NP_001276972
OMIM: 170261
HGNC: 44
Ensembl: ENSG00000204267
Vega: OTTHUMG00000031068
Pharos: Q03519(Tbio)
UniProt: Q03519 Q5JNW1
Structure
PDB: 

Position
6p21.32
AA seq 686 aa AA seqDB search
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLG
FVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLS
PPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDIL
GGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHM
PFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALE
QCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHC
YLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDV
GEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIA
HRLQTVQRAHQILVLQEGKLQKLAQL
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccctgacctgagaccctggacctccctgctgctggtggacgcggctttactg
tggctgcttcagggccctctggggactttgcttcctcaagggctgccaggactatggctg
gaggggaccctgcggctgggagggctgtgggggctgctaaagctaagagggctgctggga
tttgtggggacactgctgctcccgctctgtctggccacccccctgactgtctccctgaga
gccctggtcgcgggggcctcacgtgctcccccagccagagtcgcttcagccccttggagc
tggctgctggtggggtacggggctgcggggctcagctggtcactgtgggctgttctgagc
cctcctggagcccaggagaaggagcaggaccaggtgaacaacaaagtcttgatgtggagg
ctgctgaagctctccaggccggacctgcctctcctcgttgccgccttcttcttccttgtc
cttgctgttttgggtgagacattaatccctcactattctggtcgtgtgattgacatcctg
ggaggtgattttgacccccatgcctttgccagtgccatcttcttcatgtgcctcttctcc
tttggcagctcactgtctgcaggctgccgaggaggctgcttcacctacaccatgtctcga
atcaacttgcggatccgggagcagcttttctcctccctgctgcgccaggacctcggtttc
ttccaggagactaagacaggggagctgaactcacggctgagctcggataccaccctgatg
agtaactggcttcctttaaatgccaatgtgctcttgcgaagcctggtgaaagtggtgggg
ctgtatggcttcatgctcagcatatcgcctcgactcaccctcctttctctgctgcacatg
cccttcacaatagcagcggagaaggtgtacaacacccgccatcaggaagtgcttcgggag
atccaggatgcagtggccagggcggggcaggtggtgcgggaagccgttggagggctgcag
accgttcgcagttttggggccgaggagcatgaagtctgtcgctataaagaggcccttgaa
caatgtcggcagctgtattggcggagagacctggaacgcgccttgtacctgctcgtaagg
agggtgctgcacttgggggtgcagatgctgatgctgagctgtgggctgcagcagatgcag
gatggggagctcacccagggcagcctgctttcctttatgatctaccaggagagcgtgggg
agctatgtgcagaccctggtatacatatatggggatatgctcagcaacgtgggagctgca
gagaaggttttctcctacatggaccgacagccaaatctgccttcacctggcacgcttgcc
cccaccactctgcagggggttgtgaaattccaagacgtctcctttgcatatcccaatcgc
cctgacaggcctgtgctcaaggggctgacgtttaccctacgtcctggtgaggtgacggcg
ctggtgggacccaatgggtctgggaagagcacagtggctgccctgctgcagaatctgtac
cagcccacagggggacaggtgctgctggatgaaaagcccatctcacagtatgaacactgc
tacctgcacagccaggtggtttcagttgggcaggagcctgtgctgttctccggttctgtg
aggaacaacattgcttatgggctgcagagctgcgaagatgataaggtgatggcggctgcc
caggctgcccacgcagatgacttcatccaggaaatggagcatggaatatacacagatgta
ggggagaagggaagccagctggctgcgggacagaaacaacgtctggccattgcccgggcc
cttgtacgagacccgcgggtcctcatcctggatgaggctactagtgccctagatgtgcag
tgcgagcaggccctgcaggactggaattcccgtggggatcgcacagtgctggtgattgct
cacaggctgcagacagttcagcgcgcccaccagatcctggtgctccaggagggcaagctg
cagaagcttgcccagctctag

DBGET integrated database retrieval system