KEGG   Homo sapiens (human): 6900
Entry
6900              CDS       T01001                                 
Symbol
CNTN2, AXT, FAME5, TAG-1, TAX, TAX1
Name
(RefSeq) contactin 2
  KO
K06760  contactin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Disease
H02213  Familial adult myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    6900 (CNTN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    6900 (CNTN2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    6900 (CNTN2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Contactins
   6900 (CNTN2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  6900 (CNTN2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 fn3 V-set Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 Izumo-Ig C2-set Adeno_E3_CR1 Interfer-bind
Other DBs
NCBI-GeneID: 6900
NCBI-ProteinID: NP_001333012
OMIM: 190197
HGNC: 2172
Ensembl: ENSG00000184144
Pharos: Q02246(Tbio)
UniProt: Q02246 A1ML24
Structure
Position
1:205042949..205078289
AA seq 1040 aa
MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTD
GRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPS
IKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFED
EGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRW
LRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR
LNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISR
SDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDL
TFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEA
TVLVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNP
ANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGG
GGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRP
YTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPAS
PSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPT
LHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPH
PGTVISHSVAMLILIGSLEL
NT seq 3123 nt   +upstreamnt  +downstreamnt
atggggacagccaccaggaggaagccacacctgctgctggtagctgctgtggcccttgtc
tcctcttcagcttggagttcagccctgggatcccaaaccaccttcgggcctgtctttgaa
gaccagcccctcagtgtgctattcccagaggagtccacggaggagcaggtgttgctggca
tgccgcgcccgggccagccctccagccacctatcggtggaagatgaatggtaccgagatg
aagctggagccaggttcccgtcaccagctggtggggggcaacctggtcatcatgaacccc
accaaggcacaggatgccggggtctaccagtgcctggcctccaacccagtgggcaccgtt
gtcagcagggaggccatcctccgcttcggctttctgcaggaattctccaaggaggagcga
gacccagtgaaagctcatgaaggctggggggtgatgttgccctgtaacccacctgcccac
tacccaggcttgtcctaccgctggctcctcaacgagttccccaacttcatcccgacggac
gggcgtcacttcgtgtcccagaccacagggaacctgtacattgcccgaaccaatgcctca
gacctgggcaactactcctgtttggccaccagccacatggacttctccaccaagagcgtc
ttcagcaagtttgctcagctcaacctggctgctgaagatacccggctctttgcacccagc
atcaaggcccggttcccagcagagacctatgcactggtggggcagcaggtcaccctggag
tgcttcgcctttgggaaccctgtcccccggatcaagtggcgcaaagtggacggctccctg
tccccgcagtggaccacagctgagcccaccctgcagatccccagcgtcagctttgaggat
gagggcacctacgagtgtgaggcggagaactccaagggccgagacaccgtgcagggccgc
atcatcgtgcaggctcagcctgagtggctaaaagtgatctcggacacagaggctgacatt
ggctccaacctgcgttggggctgtgcagccgccggcaagccccggcctacagtgcgctgg
ctgcggaacggggagcctctggcctcccagaaccgggtggaggtgttggctggggacctg
cggttctccaagctgagcctggaagactcgggcatgtaccagtgtgtggcagagaataag
cacggtaccatctacgccagcgccgagctagccgtgcaagcactcgcccctgacttcagg
ctgaatcccgtgaggcgtctgatccccgcggcccgcgggggagagatccttatcccctgc
cagccccgggcagctccaaaggccgtggtgctctggagcaaaggcacggagattttggtc
aacagcagcagagtgactgtaactccagatggcaccttgatcataagaaacatcagccgg
tcagatgaaggcaaatacacctgctttgctgagaacttcatgggcaaagccaacagcact
ggaatcctatctgtgcgagatgcaaccaaaatcactctagccccctcaagtgccgacatc
aacttgggtgacaacctgaccctacagtgccatgcctcccacgaccccaccatggacctc
accttcacctggaccctggacgacttccccatcgactttgataagcctggagggcactac
cggagaactaatgtgaaggagaccattggggatctgaccatcctgaacgcccagctgcgc
catggggggaagtacacgtgcatggcccagacggtggtggacagcgcgtccaaggaggcc
acagtcctggtccgaggtccgccaggtcccccaggaggtgtggtggtgagggacattggc
gacaccaccatccagctcagctggagccgtggcttcgacaaccacagccccatcgctaag
tacaccctgcaagctcgcactccacctgcagggaagtggaagcaggttcggaccaatcct
gcaaacatcgagggcaatgccgagactgcacaggtgctgggcctcaccccctggatggac
tatgagttccgggtcatagccagcaacattctgggcactggggagcctagtgggccctcc
agcaaaatccggaccagggaagcagccccctcggtggcaccctcaggactcagcggagga
ggtggagcccccggagagctcatcgtcaactggacgcccatgtcacgggagtaccagaac
ggagacggcttcggctacctgctgtccttccgcaggcagggcagcactcactggcagacc
gcccgggtgcctggcgccgatgcccagtactttgtctacagcaacgagagcgtccggccc
tacacgccctttgaggtcaagatccgcagctacaaccgccgcggggatgggcccgagagc
ctcactgcactcgtgtactcagctgaggaagagcccagggtggcccctaccaaggtgtgg
gccaaaggggtctcatcctcagagatgaacgtgacctgggaacccgtgcagcaggacatg
aatggtatcctcctggggtatgagatccgctactggaaagctggggacaaagaagcagct
gcggaccgagtgaggacagcagggctggacaccagtgcccgagtcagcggcctgcatccc
aacaccaagtaccatgtgaccgtgagggcctacaaccgggctggcactgggcctgccagc
ccttctgccaacgccacgaccatgaagccccctccgcggcgacctcctggcaacatctcc
tggactttctcaagctctagtcttagcattaagtgggaccctgtggtccctttccgaaat
gagtctgcagtcaccggctataagatgctgtaccagaatgacttacacctgactcccacg
ctccacctcaccggcaagaactggatagaaatcccagtgcctgaagacattggccatgcc
ctggtacaaattcggaccacagggcccggaggggatgggatccctgcagaagtccacatc
gtgaggaatggaggcacaagcatgatggtggagaacatggcagtccgcccagcaccacac
cctggcaccgtcatttcccactccgtggcgatgctgatcctcataggctccctggagctc
tga

DBGET integrated database retrieval system