KEGG   Homo sapiens (human): 6917Help
Entry
6917              CDS       T01001                                 

Gene name
TCEA1, GTF2S, SII, TCEA, TF2S, TFIIS
Definition
(RefSeq) transcription elongation factor A1
  KO
K03145  transcription elongation factor S-II
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6917 (TCEA1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     6917 (TCEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DBD_Tnp_Mut
Motif
Other DBs
NCBI-GeneID: 6917
NCBI-ProteinID: NP_006747
OMIM: 601425
HGNC: 11612
Ensembl: ENSG00000187735
Vega: OTTHUMG00000164262
Pharos: P23193(Tbio)
UniProt: P23193 A0A384MTX4
Structure
PDB: 

Position
8q11.23
AA seq 301 aa AA seqDB search
MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDE
EVTSLAKSLIKSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET
NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI
RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF
C
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaagtggtccgctttgccaagaagatggacaagatggtgcagaagaagaac
gcggctggagcattggatttgctaaaggagcttaagaatattcctatgaccctggaatta
ctgcagtccacaagaatcggaatgtcagttaatgctattcgcaagcagagtacagatgag
gaagttacatctttggcaaagtctctcatcaaatcctggaaaaaattattagatgggcca
tcaactgagaaagaccttgacgaaaagaagaaagaacctgcaattacatcgcagaacagc
cctgaggcaagagaagaaagtacttccagcggcaatgtaagcaacagaaaggatgagaca
aatgctcgagatacttatgtttcatcctttcctcgggcaccaagcacttctgattctgtg
cggttgaagtgtagggagatgcttgctgcagctcttcgaacaggggatgactacattgca
attggagctgatgaggaagaattaggatctcaaattgaagaagctatatatcaagaaata
aggaatacagacatgaaatacaaaaatagagtacgaagtaggatatcaaatcttaaagat
gcaaaaaatccaaatttaaggaaaaatgtcctctgtgggaatattcctcctgacttattt
gctagaatgacagcagaggaaatggctagtgatgagctgaaagagatgcggaaaaacttg
accaaagaagccatcagagagcatcagatggccaagactggtgggacccagactgacttg
ttcacatgtggcaaatgtaaaaagaagaattgcacttacacacaggtacaaacccgtagt
gctgatgaaccaatgacaacatttgttgtctgtaatgaatgtggaaatcgatggaagttc
tgttga

DBGET integrated database retrieval system