KEGG   Homo sapiens (human): 6919Help
Entry
6919              CDS       T01001                                 

Gene name
TCEA2, TFIIS
Definition
(RefSeq) transcription elongation factor A2
  KO
K03145  transcription elongation factor S-II
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6919 (TCEA2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     6919 (TCEA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DBD_Tnp_Mut
Motif
Other DBs
NCBI-GeneID: 6919
NCBI-ProteinID: NP_003186
OMIM: 604784
HGNC: 11614
Ensembl: ENSG00000171703
Vega: OTTHUMG00000033026
Pharos: Q15560(Tbio)
UniProt: Q15560 Q6IB64
Structure
PDB: 

Position
20q13.33
AA seq 299 aa AA seqDB search
MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQS
SDEEVIALAKSLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAP
STPRITTFPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGN
TDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTK
EAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcaaggaagaggagattgcgcggatcgcccggaggctggacaagatggtgacc
aagaagagcgcggagggagccatggatttgctgcgggagctgaaggccatgcctatcacg
ctgcacctgctccagtccacccgagtcgggatgtctgtcaacgcccttcggaagcagagc
tcggatgaggaggtcattgcactggccaagtctctcatcaagtcctggaagaagctcctg
gatgcttccgatgccaaagccagggagcgggggaggggcatgcctctgcccacgtcctcg
agggatgcctcagaggccccggatcccagccgcaagaggccggagctgcccagggcaccg
tcgactccgaggatcaccacatttcctccggtgcctgtcacctgtgatgccgtgcgcaac
aagtgccgcgagatgctgaccgctgccctgcagacggaccatgaccacgtggccatcggt
gcggactgcgagcgcctgtcggctcagatcgaggaatgcatcttccgggacgttggaaac
acagacatgaagtataagaaccgtgtacggagtcgtatctccaacctgaaggatgccaag
aaccctgacctgcggcggaatgtgctgtgtggggccataacaccccagcagatcgctgtg
atgacctcagaggagatggccagtgatgagctgaaggagatccgtaaggccatgaccaag
gaggccatccgagagcaccagatggcccgcactggcggcacgcagacagacctgttcacc
tgcggcaagtgcaggaaaaagaactgcacctacacacaggtgcagacccgcagctctgat
gagcccatgaccacctttgttgtctgcaacgagtgtggaaaccgctggaagttctgctga

DBGET integrated database retrieval system