KEGG   Homo sapiens (human): 6921Help
Entry
6921              CDS       T01001                                 

Gene name
ELOC, SIII, TCEB1
Definition
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Module
hsa_M00383  ECV complex
hsa_M00388  ECS complex
Network
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6921 (ELOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6921 (ELOC)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6921 (ELOC)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    6921 (ELOC)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    6921 (ELOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6921 (ELOC)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6921 (ELOC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     6921 (ELOC)
   ECS complex
     6921 (ELOC)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     6921 (ELOC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Skp1_POZ PTAC
Motif
Other DBs
NCBI-GeneID: 6921
NCBI-ProteinID: NP_001191786
OMIM: 600788
HGNC: 11617
Ensembl: ENSG00000154582
Vega: OTTHUMG00000164501
Pharos: Q15369(Tbio)
UniProt: Q15369 A0A024R7Y5
Structure
PDB: 

Position
8q21.11
AA seq 112 aa AA seqDB search
MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggatggagaggagaaaacctatggtggctgtgaaggacctgatgccatgtatgtcaaa
ttgatatcatctgatggccatgaatttattgtaaaaagagaacatgcattaacatcaggc
acgataaaagccatgttgagtggcccaggtcagtttgctgagaacgaaaccaatgaggtc
aattttagagagataccttcacatgtgctatcgaaagtatgcatgtattttacgtacaag
gttcgctacactaacagctccaccgagattcctgaattcccaattgcacctgaaattgca
ctggaactgctgatggctgcgaacttcttagattgttaa

DBGET integrated database retrieval system