KEGG   Homo sapiens (human): 6923Help
Entry
6923              CDS       T01001                                 

Gene name
ELOB, SIII, TCEB2
Definition
(RefSeq) elongin B
  KO
K03873  elongin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Module
hsa_M00383  ECV complex
hsa_M00388  ECS complex
Network
N00080  Loss of VHL to HIF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6923 (ELOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    6923 (ELOB)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    6923 (ELOB)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    6923 (ELOB)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    6923 (ELOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6923 (ELOB)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6923 (ELOB)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     6923 (ELOB)
   ECS complex
     6923 (ELOB)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     6923 (ELOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 6923
NCBI-ProteinID: NP_009039
OMIM: 600787
HGNC: 11619
Ensembl: ENSG00000103363
Vega: OTTHUMG00000154125
Pharos: Q15370(Tbio)
UniProt: Q15370
Structure
PDB: 

Position
16p13.3
AA seq 118 aa AA seqDB search
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag
tccagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggcctcctgac
gagcagcggctgtacaaggatgaccaactcttggatgatggcaagacactgggcgagtgt
ggcttcaccagtcaaacagcacggccacaggccccagccacagtggggctggccttccgg
gcagatgacacctttgaggccctgtgcatcgagccgttttccagcccgccagagctgccc
gatgtgatgaagccccaggactcgggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system