KEGG   Homo sapiens (human): 6924Help
Entry
6924              CDS       T01001                                 

Gene name
ELOA, SIII, SIII_p110, TCEB3, TCEB3A
Definition
(RefSeq) elongin A
  KO
K15076  elongin-A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6924 (ELOA)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     6924 (ELOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Elongin_A Med26
Motif
Other DBs
NCBI-GeneID: 6924
NCBI-ProteinID: NP_003189
OMIM: 600786
HGNC: 11620
Ensembl: ENSG00000011007
Vega: OTTHUMG00000002957
Pharos: Q14241(Tbio)
UniProt: Q14241
Structure
PDB: 

Position
1p36.11
AA seq 798 aa AA seqDB search
MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLS
TLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNS
RKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDE
RKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGH
SNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKA
LSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPE
KAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKL
PKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAF
SSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPY
SVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQ
DAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKI
APMMAKTIKAFKNRFSRR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcacggagggcggagctgcggcccgaggacgcgacgcgagcccagttccggcgaggag
gccgcgccagtgacagcgatggcggcggagtcggcgctccaagttgtggagaagctgcag
gcgcgcctggccgcgaacccggaccctaagaagctattgaaatatttgaagaaactctcc
accctgcctattacagtagacattcttgcggagactggggttgggaaaacagtaaatagc
ttgcgaaaacacgagcatgttggaagctttgccagggacctagtggcccagtggaagaag
ctggttcctgtggaacgaaatgctgagcctgatgaacaggactttgagaagagcaattcc
cgaaagcgccctcgggatgccctgcagaaggaggaggagatggagggggactaccaagaa
acctggaaagccacggggagccgatcctatagccctgaccacaggcagaagaaacatagg
aaactctcggagctcgagagacctcacaaagtgtctcacggtcatgagaggagagatgag
agaaagaggtgtcacagaatgtcaccaacttactcttcagaccctgagtcttctgattat
ggccatgttcaatcccctccatcttgtaccagtcctcatcagatgtacgtcgaccactac
agatccctggaggaggaccaggagcccattgtttcacaccagaagcctgggaaaggccac
agcaatgcctttcaggacagactcggggccagccaagaacgacacctgggtgaaccccat
gggaaaggggttgtgagtcaaaacaaggagcacaaatcttcccacaaggacaaacgcccc
gtggatgccaagagtgatgagaaggcctctgtggtgagcagagagaaatcacacaaggcc
ctctccaaagaggagaaccgaaggccaccctcaggggacaatgcaagggagaaaccgccc
tctagtggcgtaaagaaagagaaggacagagagggcagcagcctgaagaagaagtgtttg
cctccctcagaggccgcttcagacaaccacctgaaaaagccaaagcacagagacccagag
aaagccaaattggacaaaagcaagcaaggtctggacagctttgacacaggaaaaggagca
ggagacctgttgcccaaggtaaaagagaagggttctaacaacctaaagactccagaaggg
aaagtcaaaactaatttggatagaaagtcactgggctccctccctaaagttgaggagaca
gatatggaggatgaattcgagcagccaaccatgtcttttgaatcctacctcagctatgac
cagccccggaagaaaaagaaaaagattgtgaaaacttcagccacggcacttggagataaa
ggacttaaaaaaaatgactctaaaagcactggtaaaaacttggactcagttcagaaatta
cccaaggtgaacaaaaccaagtcagagaagccggctggagctgatttagccaagctgaga
aaggtgcctgatgtgttgccagtgttgccagacctcccgttacccgcgatacaggccaat
taccgtccactgccttccctcgagctgatatcctccttccagccaaagcgaaaagcgttc
tcttcaccccaggaagaagaagaagctggatttactgggcgcagaatgaattccaagatg
caggtgtattctggttccaagtgtgcctatctccctaaaatgatgaccttgcaccagcaa
tgcatccgagtacttaaaaacaacatcgattcaatctttgaagtgggaggagtcccatac
tctgttcttgaacccgttttggagaggtgtacacctgatcagctgtatcgcatagaggaa
tacaatcatgtattaattgaagaaacagatcaattatggaaagttcattgtcaccgagac
tttaaggaagaaagacccgaagagtatgagtcgtggcgagagatgtacctgcggcttcag
gacgcccgagagcagcggctacgagtactaacaaagaatatccagttcgcacatgccaat
aagcccaaaggccgacaagcaaagatggcctttgtcaactctgtggccaagccacctcgt
gacgtccggaggaggcaggaaaagtttggaacgggaggagcagctgtccctgagaaaatc
aagatcaagccagccccgtaccccatgggaagcagccatgcttccgccagtagcatcagc
tttaaccccagccctgaggagccggcctatgatggcccaagcaccagcagtgcccacttg
gcaccagtggtcagcagcactgtttcctatgatcctaggaaacccactgtgaagaaaatt
gccccaatgatggccaagacaattaaagctttcaagaacagattctcccgacgataa

DBGET integrated database retrieval system