KEGG   Homo sapiens (human): 6938Help
Entry
6938              CDS       T01001                                 

Gene name
TCF12, CRS3, HEB, HTF4, HsT17266, TCF-12, bHLHb20, p64
Definition
(RefSeq) transcription factor 12
  KO
K15603  transcription factor 4/12
Organism
hsa  Homo sapiens (human)
Disease
H02160  Craniosynostoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6938 (TCF12)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Ubiquitous (class A) factors
    6938 (TCF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 6938
NCBI-ProteinID: NP_001309086
OMIM: 600480
HGNC: 11623
Ensembl: ENSG00000140262
Vega: OTTHUMG00000132047
Pharos: Q99081(Tbio)
UniProt: Q99081 A0A024R5T1
Structure
PDB: 

Position
15q21.3
AA seq 682 aa AA seqDB search
MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW
GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLY
SRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQA
KKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSS
SNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRG
STSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNP
STPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVG
PSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNH
SVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKS
DDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKEL
GRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAE
PPTTLPGTHPGLSETTNPMGHM
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccagcaacaacgcatggccgctatagggaccgacaaggagctgagcgaccta
ctggacttcagtgcgatgttttccccacctgttaatagtgggaaaactagaccaactaca
ctgggaagcagtcaattcagtggatcaggtattgatgaaagaggaggtacaacatcttgg
ggaacaagtggtcaaccaagtccttcctatgattcatctagaggttttacagacagccct
cattacagtgatcacttgaatgacagtcgattaggagcccatgaaggcttgtccccaaca
cctttcatgaactcaaatctgatgggaaaaacatcagagagaggctcattttccctgtac
agcagagatactggattaccaggctgtcaatctagtctcctgagacaagatctggggctt
gggagcccagcacagctatcttcttcaggaaaacctgggacagcatactattcattctct
gctacaagttccaggaggagaccactccatgactctgcagcgcttgatcccttgcaagca
aaaaaagtcagaaaggtgcctcctggtttgccttcttctgtatatgcaccatccccaaat
tcagatgatttcaaccgtgaatctcctagttatccatctcctaagccaccaaccagtatg
ttcgctagcactttctttatgcaagatgggacccacaattcttctgacctttggagttca
tcaaatgggatgagccagcctggttttggtggaattctggggacctccacttcccacatg
tctcaatccagtagttatggcaaccttcattcacatgaccgcttgagttatcctccacac
tcagtttcaccaacagacataaacacgagtcttccaccaatgtccagctttcatcgcggc
agtaccagcagttcaccttacgttgctgcctcacacactcctcccatcaatggatcagac
agcattctaggaaccagagggaatgctgctggaagctcacagacaggtgatgcacttgga
aaggctttggcatctatttattctcctgaccataccagcagtagttttccgtcaaatcca
tcaacaccagttggatcaccttcacctctcacaggtaccagtcagtggccaagacctgga
gggcaagcaccttcatccccaagctatgaaaactcactccactccctgcagtctcgaatg
gaggatcgtttagacagactggatgatgcaatccatgtgctgcggaaccatgctgtggga
ccttccaccagtttgcctgctggtcacagtgatatacatagtttattgggaccatcccat
aatgcaccaattggaagcctcaattcaaactatggaggatcaagccttgttgcaagcagt
cgatcagcttcaatggttggaactcatcgggaagactctgtcagtctcaatggcaatcat
tcagtcctgtctagtacagtcactacttcaagcacagacctgaaccataaaacacaagaa
aattatagaggtggcttgcaaagtcagtctggaactgttgttacaacagaaatcaagact
gaaaacaaagaaaaggatgaaaaccttcatgaacctccttcatcagatgacatgaagtca
gatgatgaatcctcccaaaaagatatcaaggtttcatctagaggcagaacaagcagtact
aatgaagatgaggatttgaaccctgaacagaagatagaaagggagaaggagaggcggatg
gctaacaatgccagagaacgcttacgcgtgcgggatattaatgaagcattcaaagagctt
ggccgaatgtgtcagcttcacttgaagagtgaaaaaccccaaacaaaactccttattctt
catcaagccgtggcagtcatccttagtctagaacagcaagtcagagagaggaaccttaac
cccaaagcagcctgccttaagagaagggaagaagaaaaagtttctgccgtatcggcagag
ccgccaaccacactgccaggaacccatcctgggcttagtgaaactaccaaccctatgggt
catatgtaa

DBGET integrated database retrieval system