KEGG   Homo sapiens (human): 6939
Entry
6939              CDS       T01001                                 

Gene name
TCF15, EC2, PARAXIS, bHLHa40
Definition
(RefSeq) transcription factor 15
  KO
K09070  transcription factor 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6939 (TCF15)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    6939 (TCF15)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 6939
NCBI-ProteinID: NP_004600
OMIM: 601010
HGNC: 11627
Ensembl: ENSG00000125878
Vega: OTTHUMG00000031640
Pharos: Q12870(Tbio)
UniProt: Q12870 A4LBB6 Q6NVX3
Position
20p13
AA seq 199 aa
MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSY
IAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgttcgcgctgctgcggcccgtcggcgcgcacgtgctgtacccggacgtgcggctg
ctgagcgaggacgaggagaaccgcagcgagagcgacgcgtcggaccagtcgttcggctgc
tgcgagggcccggaggcggcgcggcgcggcccgggccccgggggcgggcggcgggcgggc
ggcggcggcggcgcgggccccgtggtggtggtgcgacagcggcaggcggccaacgcgcgg
gagcgggaccgcactcagagcgtgaacacggccttcacggcgctgcgcacgctcatcccc
accgagccggtggaccgcaagctgtccaagatcgagacgctgcgcctggcgtccagctac
atcgcgcacctggccaacgtgctgctgctgggcgactcggccgacgacgggcagccgtgc
ttccgtgccgcgggcagtgccaagggcgccgtccccgccgccgccgacggcggccgccag
ccgcgctccatctgcaccttctgcctcagcaaccagcgcaaggggggtggccgtcgtgac
ctggggggcagctgcttgaaggtgaggggggtggccccccttcgagggccacggagatga

DBGET integrated database retrieval system