KEGG   Homo sapiens (human): 6947
Entry
6947              CDS       T01001                                 

Gene name
TCN1, HC, TC-1, TC1, TCI
Definition
(RefSeq) transcobalamin 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cobalamin_bind DUF4430
Other DBs
NCBI-GeneID: 6947
NCBI-ProteinID: NP_001053
OMIM: 189905
HGNC: 11652
Ensembl: ENSG00000134827
Vega: OTTHUMG00000167400
Pharos: P20061(Tbio)
UniProt: P20061
Structure
PDB: 
4KKI 4KKJ

Position
11q12.1
AA seq 433 aa
MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLS
LKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLID
KLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFG
SQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGN
TFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL
DINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNVTVLNGSVFLS
VMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV
RNGENLEVRWSKY
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagacagtcacaccagctgcccctagtggggctcttactgttttcttttattccaagc
caactatgcgagatttgtgaggtaagtgaagaaaactacatccgcctaaaacctctgttg
aatacaatgatccagtcaaactataacaggggaaccagcgctgtcaatgttgtgttgtcc
ctcaaacttgttggaatccagatccaaaccctgatgcaaaagatgatccaacaaatcaaa
tacaatgtgaaaagcagattgtcagatgtaagctcgggagagcttgccttgattatactg
gctttgggagtatgtcgtaacgctgaggaaaacttaatatatgattaccacctgatcgac
aagctagaaaataaattccaagcagaaattgaaaatatggaagcacacaatggcactccc
ctgactaactactaccagctcagcctggacgttttggccttgtgtctgttcaatgggaac
tactcaaccgccgaagttgtcaaccacttcactcctgaaaataaaaactattattttggt
agccagttctcagtagatactggtgcaatggctgtcctggctctgacctgtgtgaagaag
agtctaataaatgggcagatcaaagcagatgaaggcagtttaaagaacatcagtatttat
acaaagtcactggtagaaaagattctgtctgagaaaaaagaaaatggtctcattggaaac
acatttagcacaggagaagccatgcaggccctctttgtatcatcagactattataatgaa
aatgactggaattgccaacaaactctgaatacagtgctcacggaaatttctcaaggagca
ttcagcaatccaaacgctgcagcccaggtcttacctgccctgatgggaaagaccttcttg
gatattaacaaagactcttcttgcgtctctgcttcaggtaacttcaacatctccgctgat
gagcctataactgtgacacctcctgactcacaatcatatatctccgtcaattactctgtg
agaatcaatgaaacatatttcaccaatgtcactgtgctaaatggttctgtcttcctcagt
gtgatggagaaagcccagaaaatgaatgatactatatttggtttcacaatggaggagcgc
tcatgggggccctatatcacctgtattcagggcctatgtgccaacaataatgacagaacc
tactgggaacttctgagtggaggcgaaccactgagccaaggagctggtagttacgttgtc
cgcaatggagaaaacttggaggttcgctggagcaaatactaa

DBGET integrated database retrieval system