KEGG   Homo sapiens (human): 6975Help
Entry
6975              CDS       T01001                                 

Gene name
TECTB
Definition
(RefSeq) tectorin beta
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 6975
NCBI-ProteinID: NP_478129
OMIM: 602653
HGNC: 11721
Ensembl: ENSG00000119913
Vega: OTTHUMG00000019056
Pharos: Q96PL2(Tbio)
UniProt: Q96PL2
Position
10q25.2
AA seq 329 aa AA seqDB search
MVTKAFVLLAIFAEASAKSCAPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCY
NGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDTTVIVKNQPVNYSFS
CTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSIKKEAPFVLEASEI
GSDLFAGVEAKGLSIRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGRDH
RATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVTCDKRKRLLRDQTGGVLVVELS
LRSRGFSSLYSFSDVLHHLIMMLGICAVL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgaaggcctttgtcttgttggccatctttgcagaagcctctgcaaaatcgtgt
gctccaaataaagcagatgtcattcttgtgttttgctatcccaaaaccatcatcaccaaa
atccccgagtgtccctatggatgggaagttcatcagctggccctcggagggctgtgttac
aatggggtccacgaaggaggttactaccaatttgtgatcccagatttatcacctaaaaac
aagtcctattgtggaacccagtctgagtacaagccacctatctatcacttctacagtcac
atcgtttccaatgacaccacagtgattgtaaaaaaccagcctgtcaactactccttctcc
tgcacctaccactccacctacttggtgaaccaggctgcctttgaccagagagtggccact
gttcacgtgaagaacgggagcatgggcacatttgagagccaactgtctctcaacttctac
actaatgccaagttctccatcaagaaagaagctccctttgtcctggaggcatccgaaatc
ggttcagatctgtttgcaggagtggaagccaaagggttaagcattaggtttaaagtggtc
ttgaacagctgttgggccaccccctcggctgacttcatgtatcccttgcagtggcagctg
atcaacaagggctgccccacggatgaaaccgtcctcgtgcatgagaatgggagagatcac
agggcaaccttccaattcaatgctttccggttccagaacatccccaaactctccaaggtg
tggttacactgtgagacgttcatctgcgacagtgagaaactctcctgcccagtgacctgc
gataaacggaagcgcctcctgcgagaccagaccgggggagtcctggtcgtggagctctcc
ctgcggagcaggggattttccagtctctatagcttctcagatgttctccaccacctcatc
atgatgttggggatttgtgccgtgttatag

DBGET integrated database retrieval system