KEGG   Homo sapiens (human): 6999
Entry
6999              CDS       T01001                                 

Symbol
TDO2, HYPTRP, TDO, TO, TPH2, TRPO
Name
(RefSeq) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
hsa_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    6999 (TDO2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     6999 (TDO2)
SSDB
Motif
Pfam: Trp_dioxygenase DUF3107
Other DBs
NCBI-GeneID: 6999
NCBI-ProteinID: NP_005642
OMIM: 191070
HGNC: 11708
Ensembl: ENSG00000151790
Vega: OTTHUMG00000161838
Pharos: P48775(Tchem)
UniProt: P48775
Structure
PDB: 
5TIA 5TI9 6A4I 4PW8

Position
4q32.1
AA seq 406 aa
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgagtgggtgcccatttttaggaaacaactttggatatacttttaaaaaactccccgta
gaaggcagcgaagaagacaaatcacaaactggtgtgaatagagccagcaaaggaggtctt
atctatgggaactacctgcatttggaaaaagttttgaatgcacaagaactgcaaagtgaa
acaaaaggaaataaaatccatgatgaacatctttttatcataactcatcaagcttatgaa
ctctggtttaagcaaatcctctgggagttggattctgttcgagagatctttcagaatggc
catgtcagagatgaaaggaacatgcttaaggttgtttctcggatgcaccgagtgtcagtg
atcctgaaactgctggtgcagcagttttccattctggagacgatgacagccttggacttc
aatgacttcagagagtacttatctccagcatcaggcttccagagtttgcaattccgacta
ttagaaaacaagataggtgttcttcagaacatgagagtcccttataacagaagacattat
cgtgataacttcaaaggagaagaaaatgaactgctacttaaatctgagcaggaaaagaca
cttctggaattagtggaggcatggctggaaagaactccaggtttagagccacatggattt
aacttctggggaaagcttgaaaaaaatatcaccagaggcctggaagaggaattcataagg
attcaggctaaagaagagtctgaagaaaaagaggaacaggtggctgaatttcagaagcaa
aaagaggtgctactgtccttatttgatgagaaacgtcatgaacatctccttagtaaaggt
gaaagacggctgtcatacagagcacttcagggagcattgatgatatatttttacagggaa
gagcctaggttccaggtgccttttcagttgctgacttctcttatggacatagattcactg
atgaccaaatggagatataaccatgtgtgcatggtgcacagaatgctgggcagcaaagct
ggcaccggtggttcctcaggctatcactacctgcgatcaactgtgagtgataggtacaag
gtatttgtagatttatttaatctttcaacatacctgattccccgacactggataccgaag
atgaacccaaccattcacaaatttctatatacagcagaatactgtgatagctcctacttc
agcagtgatgaatcagattaa

DBGET integrated database retrieval system