KEGG   Homo sapiens (human): 7001Help
Entry
7001              CDS       T01001                                 

Gene name
PRDX2, HEL-S-2a, NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA
Definition
(RefSeq) peroxiredoxin 2
  KO
K03386  peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7001 (PRDX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     7001 (PRDX2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7001 (PRDX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 7001
NCBI-ProteinID: NP_005800
OMIM: 600538
HGNC: 9353
Ensembl: ENSG00000167815
Vega: OTTHUMG00000134285
Pharos: P32119(Tbio)
UniProt: P32119 V9HW12
Structure
PDB: 

Position
19p13.13
AA seq 198 aa AA seqDB search
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtaacgcgcgcatcggaaagccagcccctgacttcaaggccacagcggtg
gttgatggcgccttcaaagaggtgaagctgtcggactacaaagggaagtacgtggtcctc
tttttctaccctctggacttcacttttgtgtgccccaccgagatcatcgcgttcagcaac
cgtgcagaggacttccgcaagctgggctgtgaagtgctgggcgtctcggtggactctcag
ttcacccacctggcttggatcaacaccccccggaaagagggaggcttgggccccctgaac
atccccctgcttgctgacgtgaccagacgcttgtctgaggattacggcgtgctgaaaaca
gatgagggcattgcctacaggggcctctttatcatcgatggcaagggtgtccttcgccag
atcactgttaatgatttgcctgtgggacgctccgtggatgaggctctgcggctggtccag
gccttccagtacacagacgagcatggggaagtttgtcccgctggctggaagcctggcagt
gacacgattaagcccaacgtggatgacagcaaggaatatttctccaaacacaattag

DBGET integrated database retrieval system