KEGG   Homo sapiens (human): 7004
Entry
7004              CDS       T01001                                 

Symbol
TEAD4, EFTR-2, RTEF1, TCF13L1, TEF-3, TEF3, TEFR-1, hRTEF-1B
Name
(RefSeq) TEA domain transcription factor 4
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7004 (TEAD4)
   04392 Hippo signaling pathway - multiple species
    7004 (TEAD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7004 (TEAD4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    7004 (TEAD4)
SSDB
Motif
Pfam: YBD TEA MSP1a
Other DBs
NCBI-GeneID: 7004
NCBI-ProteinID: NP_003204
OMIM: 601714
HGNC: 11717
Ensembl: ENSG00000197905
Vega: OTTHUMG00000168153
Pharos: Q15561(Tbio)
UniProt: Q15561
Structure
Position
12:2959397..3040676
AA seq 434 aa
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPP
CGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQ
AAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPF
SQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
TYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWA
DLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYR
IHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS
EHGAQHHIYRLVKE
NT seq 1305 nt   +upstreamnt  +downstreamnt
ttggagggcacggccggcaccattacctccaacgagtggagctctcccacctcccctgag
gggagcaccgcctctgggggcagtcaggcactggacaagcccatcgacaatgacgcagag
ggcgtgtggagcccggatattgagcagagtttccaggaggccctcgccatctacccgccc
tgtggcaggcgcaaaatcatcctgtcggacgagggcaagatgtatggtcggaacgagctg
attgcccgctacatcaagctccggacagggaagacccgcaccaggaagcaggtctccagc
cacatccaggtgctggctcgtcgcaaagctcgcgagatccaggccaagctaaaggaccag
gcagctaaggacaaggccctgcagagcatggctgccatgtcgtctgcacagatcatctcc
gccacggccttccacagtagcatggccctcgcccggggccccggccgcccagcagtctca
gggttttggcaaggagctttgccaggccaagccggaacgtcccatgatgtgaagcctttc
tctcagcaaacctatgctgtccagcctccgctgcctctgccagggtttgagtctcctgca
gggcccgccccatcgccctctgcgcccccggcacccccatggcagggccgcagcgtggcc
agctccaagctctggatgttggagttctctgccttcctggagcagcagcaggacccggac
acgtacaacaagcacctgttcgtgcacattggccagtccagcccaagctacagcgacccc
tacctcgaagccgtggacatccgccaaatctatgacaaattcccggagaaaaagggtgga
ctcaaggatctcttcgaacggggaccctccaatgccttttttcttgtgaagttctgggca
gacctcaacaccaacatcgaggatgaaggcagctccttctatggggtctccagccagtat
gagagccccgagaacatgatcatcacctgctccacgaaggtctgctctttcggcaagcag
gtggtggagaaagttgagacagagtatgctcgctatgagaatggacactactcttaccgc
atccaccggtccccgctctgtgagtacatgatcaacttcatccacaagctcaagcacctc
cctgagaagtacatgatgaacagcgtgctggagaacttcaccatcctgcaggtggtcacc
aacagagacacacaggagaccttgctgtgcattgcctatgtctttgaggtgtcagccagt
gagcacggggctcagcaccacatctacaggctggtgaaagaatga

DBGET integrated database retrieval system