KEGG   Homo sapiens (human): 7008
Entry
7008              CDS       T01001                                 
Symbol
TEF
Name
(RefSeq) TEF transcription factor, PAR bZIP family member
  KO
K09058  thyrotrophic embryonic factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7008 (TEF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    7008 (TEF)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Cnn_1N bZIP_Maf Macoilin
Other DBs
NCBI-GeneID: 7008
NCBI-ProteinID: NP_003207
OMIM: 188595
HGNC: 11722
Ensembl: ENSG00000167074
Pharos: Q10587(Tbio)
UniProt: Q10587
Structure
Position
22:41367455..41399326
AA seq 303 aa
MSDAGGGKKPPVDPQAGPGPGPGRAAGERGLSGSFPLVLKKLMENPPREARLDKEKGKEK
LEEDEAAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHN
LLLPVAELEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVD
VNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFVPDEQKDEKYWTRR
KKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELRKEVGKCKTIVSKYETKY
GPL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtccgacgcgggcggcggaaagaagccgcctgtggacccgcaggcaggacccggtccg
gggccggggcgcgcagctggggaaaggggcctgtcggggtccttccccctggtcctgaag
aagctgatggagaaccccccgcgcgaggcgcgcctcgataaggaaaaggggaaggaaaag
ctggaggaggacgaggccgcagccgccagcaccatggctgtctcagcctccctcatgcca
cccatctgggacaagaccatcccatatgatggcgaatctttccacctggagtacatggac
ctggatgagttcctgctggagaatggcatccccgccagccccacccacctggcccacaac
ctgctgctgcctgtagcagagctagaagggaaggagtctgccagctcttccacagcatcc
ccaccatcctcctccactgccatctttcagccctctgaaaccgtgtccagcacagaatct
tccctggagaaggagagggagactcccagtcccatcgaccccaattgtgtggaagtggat
gtgaacttcaatccggaccccgccgacctggtgctctccagtgtgccaggcggggagctc
ttcaaccctcggaagcacaagtttgctgaggaggacctgaagccccagcctatgatcaaa
aaggccaagaaggtctttgtccccgacgagcagaaggatgaaaagtactggacaagacgc
aagaagaacaacgtggcagctaaacggtcacgggatgcccggcgcctgaaagagaatcag
atcaccatccgggcagccttcctggagaaggagaacacagccctgcggacggaggtggcc
gagctacgcaaggaggtgggcaagtgcaagaccatcgtgtccaagtatgagaccaaatac
gggcccttgtaa

DBGET integrated database retrieval system