KEGG   Homo sapiens (human): 7015
Entry
7015              CDS       T01001                                 
Symbol
TERT, CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT
Name
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06166  Human papillomavirus (HPV)
nt06232  Telomerase activity
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
  Element
N00240  TERT-overexpression to telomerase activity
N00373  HPV E6 to NFX1-mediated transcription
N00512  HTLV-1 Tax to c-myc-mediated transcription
Disease
H00003  Acute myeloid leukemia
H00018  Gastric cancer
H00038  Melanoma
H00048  Hepatocellular carcinoma
H00507  Dyskeratosis congenita
H00764  Chromosome 5p deletion syndrome
H01132  Aplastic anemia
H01299  Idiopathic pulmonary fibrosis
H01667  Medulloblastoma
H02569  Pulmonary fibrosis and/or bone marrow failure, telomere-related
Drug target
Imetelstat: D09629
Imetelstat sodium: D09630
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7015 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7015 (TERT)
   05226 Gastric cancer
    7015 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7015 (TERT)
   05165 Human papillomavirus infection
    7015 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7015 (TERT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     7015 (TERT)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    7015 (TERT)
   Telomerase complex (fungi)
    7015 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 7015
NCBI-ProteinID: NP_937983
OMIM: 187270
HGNC: 11730
Ensembl: ENSG00000164362
Pharos: O14746(Tchem)
UniProt: O14746
Structure
Position
5:complement(1253167..1295068)
AA seq 1132 aa
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgcctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgagtgctgcagaggctgtgcgagcgcggcgcgaagaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcgggggcccccccgaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcgggccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaccccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtcagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggcccaggcgt
ggcgctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccgggc
aggacgcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccgaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgcct
tgtcccccggtgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccctccttcctactcagctctctgaggcccagcctgactggcgctcggaggctc
gtggagaccatctttctgggttccaggccctggatgccagggactccccgcaggttgccc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccac
gcgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgagctgcggtcacc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctccctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagtgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcaaaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcggaagcagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctgcggccgattgtgaacatggactacgtcgtg
ggagccagaacgttccgcagagaaaagagggccgagcgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccggcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcaccttcgtgctgcgtgtgcgggcccag
gacccgccgcctgagctgtactttgtcaaggtggatgtgacgggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacgtactgc
gtgcgtcggtatgccgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccacgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgccgtcgtcatcgagcagagctcctccctgaatgag
gccagcagtggcctcttcgacgtcttcctacgcttcatgtgccaccacgccgtgcgcatc
aggggcaagtcctacgtccagtgccaggggatcccgcagggctccatcctctccacgctg
ctctgcagcctgtgctacggcgacatggagaacaagctgtttgcggggattcggcgggac
gggctgctcctgcgtttggtggatgatttcttgttggtgacacctcacctcacccacgcg
aaaaccttcctcaggaccctggtccgaggtgtccctgagtatggctgcgtggtgaacttg
cggaagacagtggtgaacttccctgtagaagacgaggccctgggtggcacggcttttgtt
cagatgccggcccacggcctattcccctggtgcggcctgctgctggatacccggaccctg
gaggtgcagagcgactactccagctatgcccggacctccatcagagccagtctcaccttc
aaccgcggcttcaaggctgggaggaacatgcgtcgcaaactctttggggtcttgcggctg
aagtgtcacagcctgtttctggatttgcaggtgaacagcctccagacggtgtgcaccaac
atctacaagatcctcctgctgcaggcgtacaggtttcacgcatgtgtgctgcagctccca
tttcatcagcaagtttggaagaaccccacatttttcctgcgcgtcatctctgacacggcc
tccctctgctactccatcctgaaagccaagaacgcagggatgtcgctgggggccaagggc
gccgccggccctctgccctccgaggccgtgcagtggctgtgccaccaagcattcctgctc
aagctgactcgacaccgtgtcacctacgtgccactcctggggtcactcaggacagcccag
acgcagctgagtcggaagctcccggggacgacgctgactgccctggaggccgcagccaac
ccggcactgccctcagacttcaagaccatcctggactga

DBGET integrated database retrieval system