KEGG   Homo sapiens (human): 7015Help
Entry
7015              CDS       T01001                                 

Gene name
TERT, CMM9, DKCA2, DKCB4, EST2, PFBMFT1, TCS1, TP2, TRT, hEST2, hTRT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06166  Human papillomavirus (HPV)
nt06232  Telomerase activity
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
  Element
N00240  TERT-overexpression to telomerase activity
N00373  HPV E6 to NFX1-mediated transcription
N00512  HTLV-1 Tax to c-myc-mediated transcription
Disease
H00018  Gastric cancer
H00048  Hepatocellular carcinoma
H00507  Dyskeratosis congenita
H00764  Chromosme 5p deletion syndrome
H01132  Aplastic anemia
H01299  Idiopathic pulmonary fibrosis
H01667  Medulloblastoma
Drug target
Imetelstat: D09629
Imetelstat sodium: D09630
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7015 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7015 (TERT)
   05226 Gastric cancer
    7015 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7015 (TERT)
   05165 Human papillomavirus infection
    7015 (TERT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7015 (TERT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     7015 (TERT)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    7015 (TERT)
   Telomerase complex (fungi)
    7015 (TERT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Telomerase_RBD RVT_1
Motif
Other DBs
NCBI-GeneID: 7015
NCBI-ProteinID: NP_937983
OMIM: 187270
HGNC: 11730
Ensembl: ENSG00000164362
Vega: OTTHUMG00000090357
Pharos: O14746(Tchem)
UniProt: O14746
Structure
PDB: 

Position
5p15.33
AA seq 1132 aa AA seqDB search
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgctccccgctgccgagccgtgcgctccctgctgcgcagccactaccgcgag
gtgctgccgctggccacgttcgtgcggcgcctggggccccagggctggcggctggtgcag
cgcggggacccggcggctttccgcgcgctggtggcccagtgcctggtgtgcgtgccctgg
gacgcacggccgccccccgccgccccctccttccgccaggtgtcctgcctgaaggagctg
gtggcccgagtgctgcagaggctgtgcgagcgcggcgcgaagaacgtgctggccttcggc
ttcgcgctgctggacggggcccgcgggggcccccccgaggccttcaccaccagcgtgcgc
agctacctgcccaacacggtgaccgacgcactgcgggggagcggggcgtgggggctgctg
ctgcgccgcgtgggcgacgacgtgctggttcacctgctggcacgctgcgcgctctttgtg
ctggtggctcccagctgcgcctaccaggtgtgcgggccgccgctgtaccagctcggcgct
gccactcaggcccggcccccgccacacgctagtggaccccgaaggcgtctgggatgcgaa
cgggcctggaaccatagcgtcagggaggccggggtccccctgggcctgccagccccgggt
gcgaggaggcgcgggggcagtgccagccgaagtctgccgttgcccaagaggcccaggcgt
ggcgctgcccctgagccggagcggacgcccgttgggcaggggtcctgggcccacccgggc
aggacgcgtggaccgagtgaccgtggtttctgtgtggtgtcacctgccagacccgccgaa
gaagccacctctttggagggtgcgctctctggcacgcgccactcccacccatccgtgggc
cgccagcaccacgcgggccccccatccacatcgcggccaccacgtccctgggacacgcct
tgtcccccggtgtacgccgagaccaagcacttcctctactcctcaggcgacaaggagcag
ctgcggccctccttcctactcagctctctgaggcccagcctgactggcgctcggaggctc
gtggagaccatctttctgggttccaggccctggatgccagggactccccgcaggttgccc
cgcctgccccagcgctactggcaaatgcggcccctgtttctggagctgcttgggaaccac
gcgcagtgcccctacggggtgctcctcaagacgcactgcccgctgcgagctgcggtcacc
ccagcagccggtgtctgtgcccgggagaagccccagggctctgtggcggcccccgaggag
gaggacacagacccccgtcgcctggtgcagctgctccgccagcacagcagcccctggcag
gtgtacggcttcgtgcgggcctgcctgcgccggctggtgcccccaggcctctggggctcc
aggcacaacgaacgccgcttcctcaggaacaccaagaagttcatctccctggggaagcat
gccaagctctcgctgcaggagctgacgtggaagatgagcgtgcgggactgcgcttggctg
cgcaggagcccaggggttggctgtgttccggccgcagagcaccgtctgcgtgaggagatc
ctggccaagttcctgcactggctgatgagtgtgtacgtcgtcgagctgctcaggtctttc
ttttatgtcacggagaccacgtttcaaaagaacaggctctttttctaccggaagagtgtc
tggagcaagttgcaaagcattggaatcagacagcacttgaagagggtgcagctgcgggag
ctgtcggaagcagaggtcaggcagcatcgggaagccaggcccgccctgctgacgtccaga
ctccgcttcatccccaagcctgacgggctgcggccgattgtgaacatggactacgtcgtg
ggagccagaacgttccgcagagaaaagagggccgagcgtctcacctcgagggtgaaggca
ctgttcagcgtgctcaactacgagcgggcgcggcgccccggcctcctgggcgcctctgtg
ctgggcctggacgatatccacagggcctggcgcaccttcgtgctgcgtgtgcgggcccag
gacccgccgcctgagctgtactttgtcaaggtggatgtgacgggcgcgtacgacaccatc
ccccaggacaggctcacggaggtcatcgccagcatcatcaaaccccagaacacgtactgc
gtgcgtcggtatgccgtggtccagaaggccgcccatgggcacgtccgcaaggccttcaag
agccacgtctctaccttgacagacctccagccgtacatgcgacagttcgtggctcacctg
caggagaccagcccgctgagggatgccgtcgtcatcgagcagagctcctccctgaatgag
gccagcagtggcctcttcgacgtcttcctacgcttcatgtgccaccacgccgtgcgcatc
aggggcaagtcctacgtccagtgccaggggatcccgcagggctccatcctctccacgctg
ctctgcagcctgtgctacggcgacatggagaacaagctgtttgcggggattcggcgggac
gggctgctcctgcgtttggtggatgatttcttgttggtgacacctcacctcacccacgcg
aaaaccttcctcaggaccctggtccgaggtgtccctgagtatggctgcgtggtgaacttg
cggaagacagtggtgaacttccctgtagaagacgaggccctgggtggcacggcttttgtt
cagatgccggcccacggcctattcccctggtgcggcctgctgctggatacccggaccctg
gaggtgcagagcgactactccagctatgcccggacctccatcagagccagtctcaccttc
aaccgcggcttcaaggctgggaggaacatgcgtcgcaaactctttggggtcttgcggctg
aagtgtcacagcctgtttctggatttgcaggtgaacagcctccagacggtgtgcaccaac
atctacaagatcctcctgctgcaggcgtacaggtttcacgcatgtgtgctgcagctccca
tttcatcagcaagtttggaagaaccccacatttttcctgcgcgtcatctctgacacggcc
tccctctgctactccatcctgaaagccaagaacgcagggatgtcgctgggggccaagggc
gccgccggccctctgccctccgaggccgtgcagtggctgtgccaccaagcattcctgctc
aagctgactcgacaccgtgtcacctacgtgccactcctggggtcactcaggacagcccag
acgcagctgagtcggaagctcccggggacgacgctgactgccctggaggccgcagccaac
ccggcactgccctcagacttcaagaccatcctggactga

DBGET integrated database retrieval system