KEGG   Homo sapiens (human): 7018Help
Entry
7018              CDS       T01001                                 

Gene name
TF, HEL-S-71p, PRO1557, PRO2086, TFQTL1
Definition
(RefSeq) transferrin
  KO
K14736  transferrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04216  Ferroptosis
hsa04978  Mineral absorption
Disease
H01145  Atransferrinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    7018 (TF)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    7018 (TF)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    7018 (TF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7018 (TF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7018 (TF)
  Exosomal proteins of colorectal cancer cells
   7018 (TF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 7018
NCBI-ProteinID: NP_001054
OMIM: 190000
HGNC: 11740
Ensembl: ENSG00000091513
Vega: OTTHUMG00000150356
Pharos: P02787(Tbio)
UniProt: P02787 Q06AH7 A0PJA6
Structure
PDB: 

Position
3q22.1
AA seq 698 aa AA seqDB search
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVV
KKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPC
ADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRD
QYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKE
FQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKP
VKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK
CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWN
IPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAF
RCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLAR
APNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKL
HDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgccgtgggagccctgctggtctgcgccgtcctggggctgtgtctggctgtc
cctgataaaactgtgagatggtgtgcagtgtcggagcatgaggccactaagtgccagagt
ttccgcgaccatatgaaaagcgtcattccatccgatggtcccagtgttgcttgtgtgaag
aaagcctcctaccttgattgcatcagggccattgcggcaaacgaagcggatgctgtgaca
ctggatgcaggtttggtgtatgatgcttacctggctcccaataacctgaagcctgtggtg
gcagagttctatgggtcaaaagaggatccacagactttctattatgctgttgctgtggtg
aagaaggatagtggcttccagatgaaccagcttcgaggcaagaagtcctgccacacgggt
ctaggcaggtccgctgggtggaacatccccataggcttactttactgtgacttacctgag
ccacgtaaacctcttgagaaagcagtggccaatttcttctcgggcagctgtgccccttgt
gcggatgggacggacttcccccagctgtgtcaactgtgtccagggtgtggctgctccacc
cttaaccaatacttcggctactcgggagccttcaagtgtctgaaggatggtgctggggat
gtggcctttgtcaagcactcgactatatttgagaacttggcaaacaaggctgacagggac
cagtatgagctgctttgcctggacaacacccggaagccggtagatgaatacaaggactgc
cacttggcccaggtcccttctcataccgtcgtggcccgaagtatgggcggcaaggaggac
ttgatctgggagcttctcaaccaggcccaggaacattttggcaaagacaaatcaaaagaa
ttccaactattcagctctcctcatgggaaggacctgctgtttaaggactctgcccacggg
tttttaaaagtcccccccaggatggatgccaagatgtacctgggctatgagtatgtcact
gccatccggaatctacgggaaggcacatgcccagaagccccaacagatgaatgcaagcct
gtgaagtggtgtgcgctgagccaccacgagaggctcaagtgtgatgagtggagtgttaac
agtgtagggaaaatagagtgtgtatcagcagagaccaccgaagactgcatcgccaagatc
atgaatggagaagctgatgccatgagcttggatggagggtttgtctacatagcgggcaag
tgtggtctggtgcctgtcttggcagaaaactacaataagagcgataattgtgaggataca
ccagaggcagggtattttgctgtagcagtggtgaagaaatcagcttctgacctcacctgg
gacaatctgaaaggcaagaagtcctgccatacggcagttggcagaaccgctggctggaac
atccccatgggcctgctctacaataagatcaaccactgcagatttgatgaatttttcagt
gaaggttgtgcccctgggtctaagaaagactccagtctctgtaagctgtgtatgggctca
ggcctaaacctgtgtgaacccaacaacaaagagggatactacggctacacaggcgctttc
aggtgtctggttgagaagggagatgtggcctttgtgaaacaccagactgtcccacagaac
actgggggaaaaaaccctgatccatgggctaagaatctgaatgaaaaagactatgagttg
ctgtgccttgatggtaccaggaaacctgtggaggagtatgcgaactgccacctggccaga
gccccgaatcacgctgtggtcacacggaaagataaggaagcttgcgtccacaagatatta
cgtcaacagcagcacctatttggaagcaacgtaactgactgctcgggcaacttttgtttg
ttccggtcggaaaccaaggaccttctgttcagagatgacacagtatgtttggccaaactt
catgacagaaacacatatgaaaaatacttaggagaagaatatgtcaaggctgttggtaac
ctgagaaaatgctccacctcatcactcctggaagcctgcactttccgtagaccttaa

DBGET integrated database retrieval system