KEGG   Homo sapiens (human): 7019Help
Entry
7019              CDS       T01001                                 

Gene name
TFAM, MTDPS15, MTTF1, MTTFA, TCF6, TCF6L1, TCF6L2, TCF6L3
Definition
(RefSeq) transcription factor A, mitochondrial
  KO
K11830  transcription factor A, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05016  Huntington disease
Disease
H00469  Mitochondrial DNA depletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    7019 (TFAM)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    7019 (TFAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7019 (TFAM)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    7019 (TFAM)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    7019 (TFAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 YABBY NAD_binding_9 Ccdc124 Tup_N
Motif
Other DBs
NCBI-GeneID: 7019
NCBI-ProteinID: NP_003192
OMIM: 600438
HGNC: 11741
Ensembl: ENSG00000108064
Vega: OTTHUMG00000018270
Pharos: Q00059(Tbio)
UniProt: Q00059 E5KSU5
Structure
PDB: 

Position
10q21.1
AA seq 246 aa AA seqDB search
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRF
SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQ
LTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQE
KLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRK
YGAEEC
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttctccgaagcatgtggggcgtgctgagtgccctgggaaggtctggagcagag
ctgtgcaccggctgtggaagtcgactgcgctcccccttcagttttgtgtatttaccgagg
tggttttcatctgtcttggcaagttgtccaaagaaacctgtaagttcttaccttcgattt
tctaaagaacaactacccatatttaaagctcagaacccagatgcaaaaactacagaacta
attagaagaattgcccagcgttggagggaacttcctgattcaaagaaaaaaatatatcaa
gatgcttatagggcggagtggcaggtatataaagaagagataagcagatttaaagaacag
ctaactccaagtcagattatgtctttggaaaaagaaatcatggacaaacatttaaaaagg
aaagctatgacaaaaaaaaaagagttaacactgcttggaaaaccaaaaagacctcgttca
gcttataacgtttatgtagctgaaagattccaagaagctaagggtgattcaccgcaggaa
aagctgaagactgtaaaggaaaactggaaaaatctgtctgactctgaaaaggaattatat
attcagcatgctaaagaggacgaaactcgttatcataatgaaatgaagtcttgggaagaa
caaatgattgaagttggacgaaaggatcttctacgtcgcacaataaagaaacaacgaaaa
tatggtgctgaggagtgttaa

DBGET integrated database retrieval system