KEGG   Homo sapiens (human): 7035Help
Entry
7035              CDS       T01001                                 

Gene name
TFPI, EPI, LACI, TFI, TFPI1
Definition
(RefSeq) tissue factor pathway inhibitor
  KO
K03909  tissue factor pathway inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Drug target
Marstacimab: D11261
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    7035 (TFPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7035 (TFPI)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis
   7035 (TFPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kunitz_BPTI
Motif
Other DBs
NCBI-GeneID: 7035
NCBI-ProteinID: NP_001316168
OMIM: 152310
HGNC: 11760
Ensembl: ENSG00000003436
Vega: OTTHUMG00000132634
Pharos: P10646(Tbio)
UniProt: P10646
Structure
PDB: 

Position
2q32.1
AA seq 304 aa AA seqDB search
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatttacacaatgaagaaagtacatgcactttgggcttctgtatgcctgctgcttaat
cttgcccctgcccctcttaatgctgattctgaggaagatgaagaacacacaattatcaca
gatacggagttgccaccactgaaacttatgcattcattttgtgcattcaaggcggatgat
ggcccatgtaaagcaatcatgaaaagatttttcttcaatattttcactcgacagtgcgaa
gaatttatatatgggggatgtgaaggaaatcagaatcgatttgaaagtctggaagagtgc
aaaaaaatgtgtacaagagataatgcaaacaggattataaagacaacattgcaacaagaa
aagccagatttctgctttttggaagaagatcctggaatatgtcgaggttatattaccagg
tatttttataacaatcagacaaaacagtgtgaacgtttcaagtatggtggatgcctgggc
aatatgaacaattttgagacactggaagaatgcaagaacatttgtgaagatggtccgaat
ggtttccaggtggataattatggaacccagctcaatgctgtgaataactccctgactccg
caatcaaccaaggttcccagcctttttgaatttcacggtccctcatggtgtctcactcca
gcagacagaggattgtgtcgtgccaatgagaacagattctactacaattcagtcattggg
aaatgccgcccatttaagtacagtggatgtgggggaaatgaaaacaattttacttccaaa
caagaatgtctgagggcatgtaaaaaaggtttcatccaaagaatatcaaaaggaggccta
attaaaaccaaaagaaaaagaaagaagcagagagtgaaaatagcatatgaagaaattttt
gttaaaaatatgtga

DBGET integrated database retrieval system