KEGG   Homo sapiens (human): 7036Help
Entry
7036              CDS       T01001                                 

Gene name
TFR2, HFE3, TFRC2
Definition
(RefSeq) transferrin receptor 2
  KO
K23910  transferrin receptor protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00211  Hemochromatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7036 (TFR2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   7036 (TFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28 PA TFR_dimer
Motif
Other DBs
NCBI-GeneID: 7036
NCBI-ProteinID: NP_003218
OMIM: 604720
HGNC: 11762
Ensembl: ENSG00000106327
Vega: OTTHUMG00000159598
Pharos: Q9UP52(Tbio)
UniProt: Q9UP52
Position
7q22.1
AA seq 801 aa AA seqDB search
MERLWGLFQRAQQLSPRSSQTVYQRVEGPRKGHLEEEEEDGEEGAETLAHFCPMELRGPE
PLGSRPRQPNLIPWAAAGRRAAPYLVLTALLIFTGAFLLGYVAFRGSCQACGDSVLVVSE
DVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIR
AALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGN
VTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPE
PADFSQDPPKPSLSSQQAVYGHVHLGTGDPYTPGFPSFNQTQFPPVASSGLPSIPAQPIS
ADIASRLLRKLKGPVAPQEWQGSLLGSPYHLGPGPRLRLVVNNHRTSTPINNIFGCIEGR
SEPDHYVVIGAQRDAWGPGAAKSAVGTAILLELVRTFSSMVSNGFRPRRSLLFISWDGGD
FGSVGSTEWLEGYLSVLHLKAVVYVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPN
HSGQTLYEQVVFTNPSWDAEVIRPLPMDSSAYSFTAFVGVPAVEFSFMEDDQAYPFLHTK
EDTYENLHKVLQGRLPAVAQAVAQLAGQLLIRLSHDRLLPLDFGRYGDVVLRHIGNLNEF
SGDLKARGLTLQWVYSARGDYIRAAEKLRQEIYSSEERDERLTRMYNVRIMRVEFYFLSQ
YVSPADSPFRHIFMGRGDHTLGALLDHLRLLRSNSSGTPGATSSTGFQESRFRRQLALLT
WTLQGAANALSGDVWNIDNNF
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctttggggtctattccagagagcgcaacaactgtccccaagatcctctcag
accgtctaccagcgtgtggaaggcccccggaaagggcacctggaggaggaagaggaagac
ggggaggagggggcggagacattggcccacttctgccccatggagctgaggggccctgag
cccctgggctctagacccaggcagccaaacctcattccctgggcggcagcaggacggagg
gctgccccctacctggtcctgacggccctgctgatcttcactggggccttcctactgggc
tacgtcgccttccgagggtcctgccaggcgtgcggagactctgtgttggtggtcagtgag
gatgtcaactatgagcctgacctggatttccaccagggcagactctactggagcgacctc
caggccatgttcctgcagttcctgggggaggggcgcctggaggacaccatcaggcaaacc
agccttcgggaacgggtggcaggctcggccgggatggccgctctgactcaggacattcgc
gcggcgctctcccgccagaagctggaccacgtgtggaccgacacgcactacgtggggctg
caattcccggatccggctcaccccaacaccctgcactgggtcgatgaggccgggaaggtc
ggagagcagctgccgctggaggaccctgacgtctactgcccctacagcgccatcggcaac
gtcacgggagagctggtgtacgcccactacgggcggcccgaagacctgcaggacctgcgg
gccaggggcgtggatccagtgggccgcctgctgctggtgcgcgtgggggtgatcagcttc
gcccagaaggtgaccaatgctcaggacttcggggctcaaggagtgctcatatacccagag
ccagcggacttctcccaggacccacccaagccaagcctgtccagccagcaggcagtgtat
ggacatgtgcacctgggaactggagacccctacacacctggcttcccttccttcaatcaa
acccagttccctccagttgcatcatcaggccttcccagcatcccagcccagcccatcagt
gcagacattgcctcccgcctgctgaggaagctcaaaggccctgtggccccccaagaatgg
caggggagcctcctaggctccccttatcacctgggccccgggccacgactgcggctagtg
gtcaacaatcacaggacctccacccccatcaacaacatcttcggctgcatcgaaggccgc
tcagagccagatcactacgttgtcatcggggcccagagggatgcatggggcccaggagca
gctaaatccgctgtggggacggctatactcctggagctggtgcggaccttttcctccatg
gtgagcaacggcttccggccccgcagaagtctcctcttcatcagctgggacggtggtgac
tttggaagcgtgggctccacggagtggctagagggctacctcagcgtgctgcacctcaaa
gccgtagtgtacgtgagcctggacaacgcagtgctgggggatgacaagtttcatgccaag
accagcccccttctgacaagtctcattgagagtgtcctgaagcaggtggattctcccaac
cacagtgggcagactctctatgaacaggtggtgttcaccaatcccagctgggatgctgag
gtgatccggcccctacccatggacagcagtgcctattccttcacggcctttgtgggagtc
cctgccgtcgagttctcctttatggaggacgaccaggcctacccattcctgcacacaaag
gaggacacttatgagaacctgcataaggtgctgcaaggccgcctgcccgccgtggcccag
gccgtggcccagctcgcagggcagctcctcatccggctcagccacgatcgcctgctgccc
ctcgacttcggccgctacggggacgtcgtcctcaggcacatcgggaacctcaacgagttc
tctggggacctcaaggcccgcgggctgaccctgcagtgggtgtactcggcgcggggggac
tacatccgggcggcggaaaagctgcggcaggagatctacagctcggaggagagagacgag
cgactgacacgcatgtacaacgtgcgcataatgcgggtggagttctacttcctttcccag
tacgtgtcgccagccgactccccgttccgccacatcttcatgggccgtggagaccacacg
ctgggcgccctgctggaccacctgcggctgctgcgctccaacagctccgggacccccggg
gccacctcctccactggcttccaggagagccgtttccggcgtcagctagccctgctcacc
tggacgctgcaaggggcagccaatgcgcttagcggggatgtctggaacattgataacaac
ttctga

DBGET integrated database retrieval system