KEGG   Homo sapiens (human): 7039Help
Entry
7039              CDS       T01001                                 

Gene name
TGFA, TFGA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05223  Non-small cell lung cancer
hsa05225  Hepatocellular carcinoma
Network
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00227  TGFA-EGFR-PLCG-PKC signaling pathway
N00228  TGFA-overexpression to PLCG-PKC signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00231  TGFA-EGFR-PI3K signaling pathway
N00232  TGFA-overexpression to PI3K signaling pathway
Disease
H00020  Colorectal cancer
H00048  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7039 (TGFA)
   04010 MAPK signaling pathway
    7039 (TGFA)
   04012 ErbB signaling pathway
    7039 (TGFA)
   04151 PI3K-Akt signaling pathway
    7039 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    7039 (TGFA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7039 (TGFA)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7039 (TGFA)
   05212 Pancreatic cancer
    7039 (TGFA)
   05225 Hepatocellular carcinoma
    7039 (TGFA)
   05214 Glioma
    7039 (TGFA)
   05211 Renal cell carcinoma
    7039 (TGFA)
   05215 Prostate cancer
    7039 (TGFA)
   05223 Non-small cell lung cancer
    7039 (TGFA)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    7039 (TGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF EGF_2 TMEM154
Motif
Other DBs
NCBI-GeneID: 7039
NCBI-ProteinID: NP_003227
OMIM: 190170
HGNC: 11765
Ensembl: ENSG00000163235
Vega: OTTHUMG00000129669
Pharos: P01135(Tbio)
UniProt: P01135
Structure
PDB: 

Position
2p13.3
AA seq 160 aa AA seqDB search
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgctctgggtattgtgttggctgcgtgc
caggccttggagaacagcacgtccccgctgagtgcagacccgcccgtggctgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system