KEGG   Homo sapiens (human): 7040Help
Entry
7040              CDS       T01001                                 

Gene name
TGFB1, CED, DPD1, LAP, TGFB, TGFbeta
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00434  Camurati-Engelmann disease
H01593  Osteoporosis
Drug target
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7040 (TGFB1)
   04350 TGF-beta signaling pathway
    7040 (TGFB1)
   04390 Hippo signaling pathway
    7040 (TGFB1)
   04068 FoxO signaling pathway
    7040 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7040 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7040 (TGFB1)
   04218 Cellular senescence
    7040 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    7040 (TGFB1)
   04672 Intestinal immune network for IgA production
    7040 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7040 (TGFB1)
  09158 Development
   04380 Osteoclast differentiation
    7040 (TGFB1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7040 (TGFB1)
   05205 Proteoglycans in cancer
    7040 (TGFB1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7040 (TGFB1)
   05212 Pancreatic cancer
    7040 (TGFB1)
   05225 Hepatocellular carcinoma
    7040 (TGFB1)
   05226 Gastric cancer
    7040 (TGFB1)
   05220 Chronic myeloid leukemia
    7040 (TGFB1)
   05211 Renal cell carcinoma
    7040 (TGFB1)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    7040 (TGFB1)
   05321 Inflammatory bowel disease (IBD)
    7040 (TGFB1)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7040 (TGFB1)
   05414 Dilated cardiomyopathy (DCM)
    7040 (TGFB1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7040 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7040 (TGFB1)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    7040 (TGFB1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7040 (TGFB1)
   05161 Hepatitis B
    7040 (TGFB1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    7040 (TGFB1)
   05144 Malaria
    7040 (TGFB1)
   05145 Toxoplasmosis
    7040 (TGFB1)
   05140 Leishmaniasis
    7040 (TGFB1)
   05142 Chagas disease (American trypanosomiasis)
    7040 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7040 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7040 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7040 (TGFB1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Others
   7040 (TGFB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7040 (TGFB1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   7040 (TGFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta Sterile
Motif
Other DBs
NCBI-GeneID: 7040
NCBI-ProteinID: NP_000651
OMIM: 190180
HGNC: 11766
Ensembl: ENSG00000105329
Vega: OTTHUMG00000182760
Pharos: P01137(Tchem)
UniProt: P01137
Structure
PDB: 

Position
19q13.2
AA seq 390 aa AA seqDB search
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgtggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcatggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Homo sapiens (human): 7042Help
Entry
7042              CDS       T01001                                 

Gene name
TGFB2, G-TSF, LDS4, TGF-beta2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00800  Loeys-Dietz syndrome
Drug target
Belagenpumatucel-L: D06563
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7042 (TGFB2)
   04350 TGF-beta signaling pathway
    7042 (TGFB2)
   04390 Hippo signaling pathway
    7042 (TGFB2)
   04068 FoxO signaling pathway
    7042 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7042 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7042 (TGFB2)
   04218 Cellular senescence
    7042 (TGFB2)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    7042 (TGFB2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7042 (TGFB2)
   05206 MicroRNAs in cancer
    7042 (TGFB2)
   05205 Proteoglycans in cancer
    7042 (TGFB2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7042 (TGFB2)
   05212 Pancreatic cancer
    7042 (TGFB2)
   05225 Hepatocellular carcinoma
    7042 (TGFB2)
   05226 Gastric cancer
    7042 (TGFB2)
   05220 Chronic myeloid leukemia
    7042 (TGFB2)
   05211 Renal cell carcinoma
    7042 (TGFB2)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    7042 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    7042 (TGFB2)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7042 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    7042 (TGFB2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7042 (TGFB2)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    7042 (TGFB2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7042 (TGFB2)
   05161 Hepatitis B
    7042 (TGFB2)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    7042 (TGFB2)
   05144 Malaria
    7042 (TGFB2)
   05145 Toxoplasmosis
    7042 (TGFB2)
   05140 Leishmaniasis
    7042 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    7042 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7042 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7042 (TGFB2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7042 (TGFB2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   7042 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 7042
NCBI-ProteinID: NP_003229
OMIM: 190220
HGNC: 11768
Ensembl: ENSG00000092969
Vega: OTTHUMG00000039521
Pharos: P61812(Tbio)
UniProt: P61812 Q59EG9
Structure
PDB: 

Position
1q41
AA seq 414 aa AA seqDB search
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaaatgccatcccgccc
actttctacagaccctacttcagaattgttcgatttgacgtctcagcaatggagaagaat
gcttccaatttggtgaaagcagagttcagagtctttcgtttgcagaacccaaaagccaga
gtgcctgaacaacggattgagctatatcagattctcaagtccaaagatttaacatctcca
acccagcgctacatcgacagcaaagttgtgaaaacaagagcagaaggcgaatggctctcc
ttcgatgtaactgatgctgttcatgaatggcttcaccataaagacaggaacctgggattt
aaaataagcttacactgtccctgctgcacttttgtaccatctaataattacatcatccca
aataaaagtgaagaactagaagcaagatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttattgccctcctacagacttgagtcacaacagaccaaccggcggaag
aagcgtgctttggatgcggcctattgctttagaaatgtgcaggataattgctgcctacgt
ccactttacattgatttcaagagggatctagggtggaaatggatacacgaacccaaaggg
tacaatgccaacttctgtgctggagcatgcccgtatttatggagttcagacactcagcac
agcagggtcctgagcttatataataccataaatccagaagcatctgcttctccttgctgc
gtgtcccaagatttagaacctctaaccattctctactacattggcaaaacacccaagatt
gaacagctttctaatatgattgtaaagtcttgcaaatgcagctaa

KEGG   Homo sapiens (human): 7043Help
Entry
7043              CDS       T01001                                 

Gene name
TGFB3, ARVD, ARVD1, LDS5, RNHF, TGF-beta3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H00293  Arrhythmogenic right ventricular cardiomyopathy
H00431  Ossification of the posterior longitudinal ligament of spine
H00800  Loeys-Dietz syndrome
H01385  Rienhoff syndrome
Drug target
Fresolimumab: D09620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7043 (TGFB3)
   04350 TGF-beta signaling pathway
    7043 (TGFB3)
   04390 Hippo signaling pathway
    7043 (TGFB3)
   04068 FoxO signaling pathway
    7043 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7043 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7043 (TGFB3)
   04218 Cellular senescence
    7043 (TGFB3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7043 (TGFB3)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7043 (TGFB3)
   05212 Pancreatic cancer
    7043 (TGFB3)
   05225 Hepatocellular carcinoma
    7043 (TGFB3)
   05226 Gastric cancer
    7043 (TGFB3)
   05220 Chronic myeloid leukemia
    7043 (TGFB3)
   05211 Renal cell carcinoma
    7043 (TGFB3)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    7043 (TGFB3)
   05321 Inflammatory bowel disease (IBD)
    7043 (TGFB3)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7043 (TGFB3)
   05414 Dilated cardiomyopathy (DCM)
    7043 (TGFB3)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7043 (TGFB3)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    7043 (TGFB3)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7043 (TGFB3)
   05161 Hepatitis B
    7043 (TGFB3)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    7043 (TGFB3)
   05144 Malaria
    7043 (TGFB3)
   05145 Toxoplasmosis
    7043 (TGFB3)
   05140 Leishmaniasis
    7043 (TGFB3)
   05142 Chagas disease (American trypanosomiasis)
    7043 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7043 (TGFB3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   7043 (TGFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 7043
NCBI-ProteinID: NP_001316868
OMIM: 190230
HGNC: 11769
Ensembl: ENSG00000119699
Vega: OTTHUMG00000171489
Pharos: P10600(Tbio)
UniProt: P10600 A5YM40
Structure
PDB: 

Position
14q24.3
AA seq 412 aa AA seqDB search
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccctaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctattccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagaggaagaagcgg
gctttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaagtggagcag
ctctccaacatggtggtgaagtcttgtaaatgtagctga

DBGET integrated database retrieval system