KEGG   Homo sapiens (human): 7046Help
Entry
7046              CDS       T01001                                 

Gene name
TGFBR1, AAT5, ACVRLK4, ALK-5, ALK5, ESS1, LDS1, LDS1A, LDS2A, MSSE, SKR4, TBR-i, TBRI, TGFR-1, tbetaR-I
Definition
(RefSeq) transforming growth factor beta receptor 1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04659  Th17 cell differentiation
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00064  Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00241  TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  TGFBR1-reduced expression to TGF-beta signaling pathway
Disease
H00018  Gastric cancer
H00800  Loeys-Dietz syndrome
H00801  Familial thoracic aortic aneurysm and dissection
Drug target
Galunisertib: D10437
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7046 (TGFBR1)
   04350 TGF-beta signaling pathway
    7046 (TGFBR1)
   04390 Hippo signaling pathway
    7046 (TGFBR1)
   04371 Apelin signaling pathway
    7046 (TGFBR1)
   04068 FoxO signaling pathway
    7046 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7046 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7046 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    7046 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    7046 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    7046 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7046 (TGFBR1)
  09158 Development
   04380 Osteoclast differentiation
    7046 (TGFBR1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7046 (TGFBR1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7046 (TGFBR1)
   05212 Pancreatic cancer
    7046 (TGFBR1)
   05225 Hepatocellular carcinoma
    7046 (TGFBR1)
   05226 Gastric cancer
    7046 (TGFBR1)
   05220 Chronic myeloid leukemia
    7046 (TGFBR1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7046 (TGFBR1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7046 (TGFBR1)
   05161 Hepatitis B
    7046 (TGFBR1)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    7046 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7046 (TGFBR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7046 (TGFBR1)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   7046 (TGFBR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 7046
NCBI-ProteinID: NP_004603
OMIM: 190181
HGNC: 11772
Ensembl: ENSG00000106799
Vega: OTTHUMG00000020353
Pharos: P36897(Tchem)
UniProt: P36897 Q5T7S2 B4DXN7
Structure
PDB: 

Position
9q22.33
AA seq 503 aa AA seqDB search
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggtcgctgctccgcgtccccggctgctcctcctcgtgctggcggcggcg
gcggcggcggcggcggcgctgctcccgggggcgacggcgttacagtgtttctgccacctc
tgtacaaaagacaattttacttgtgtgacagatgggctctgctttgtctctgtcacagag
accacagacaaagttatacacaacagcatgtgtatagctgaaattgacttaattcctcga
gataggccgtttgtatgtgcaccctcttcaaaaactgggtctgtgactacaacatattgc
tgcaatcaggaccattgcaataaaatagaacttccaactactgtaaagtcatcacctggc
cttggtcctgtggaactggcagctgtcattgctggaccagtgtgcttcgtctgcatctca
ctcatgttgatggtctatatctgccacaaccgcactgtcattcaccatcgagtgccaaat
gaagaggacccttcattagatcgcccttttatttcagagggtactacgttgaaagactta
atttatgatatgacaacgtcaggttctggctcaggtttaccattgcttgttcagagaaca
attgcgagaactattgtgttacaagaaagcattggcaaaggtcgatttggagaagtttgg
agaggaaagtggcggggagaagaagttgctgttaagatattctcctctagagaagaacgt
tcgtggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaacatcctg
ggatttatagcagcagacaataaagacaatggtacttggactcagctctggttggtgtca
gattatcatgagcatggatccctttttgattacttaaacagatacacagttactgtggaa
ggaatgataaaacttgctctgtccacggcgagcggtcttgcccatcttcacatggagatt
gttggtacccaaggaaagccagccattgctcatagagatttgaaatcaaagaatatcttg
gtaaagaagaatggaacttgctgtattgcagacttaggactggcagtaagacatgattca
gccacagataccattgatattgctccaaaccacagagtgggaacaaaaaggtacatggcc
cctgaagttctcgatgattccataaatatgaaacattttgaatccttcaaacgtgctgac
atctatgcaatgggcttagtattctgggaaattgctcgacgatgttccattggtggaatt
catgaagattaccaactgccttattatgatcttgtaccttctgacccatcagttgaagaa
atgagaaaagttgtttgtgaacagaagttaaggccaaatatcccaaacagatggcagagc
tgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaatggagca
gctaggcttacagcattgcggattaagaaaacattatcgcaactcagtcaacaggaaggc
atcaaaatgtaa

KEGG   Homo sapiens (human): 7048Help
Entry
7048              CDS       T01001                                 

Gene name
TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TBR-ii, TBRII, TGFR-2, TGFbeta-RII
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
hsa04218  Cellular senescence
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04659  Th17 cell differentiation
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05142  Chagas disease (American trypanosomiasis)
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00680  TGF-beta signaling
Network
N00063  TGF-beta signaling pathway
N00064  Mutation-inactivated TGFBR2 to TGF-beta signaling pathway
N00065  Mutation-inactivated SMAD2 to TGF-beta signaling pathway
N00134  EWSR1-FLI1 fusion to transcriptional repression
N00241  TGFBR2-reduced expression to TGF-beta signaling pathway
N00256  TGFBR1-reduced expression to TGF-beta signaling pathway
Disease
H00020  Colorectal cancer
H00048  Hepatocellular carcinoma
H00800  Loeys-Dietz syndrome
H00801  Familial thoracic aortic aneurysm and dissection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7048 (TGFBR2)
   04350 TGF-beta signaling pathway
    7048 (TGFBR2)
   04390 Hippo signaling pathway
    7048 (TGFBR2)
   04068 FoxO signaling pathway
    7048 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7048 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7048 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    7048 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    7048 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    7048 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7048 (TGFBR2)
  09158 Development
   04380 Osteoclast differentiation
    7048 (TGFBR2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7048 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    7048 (TGFBR2)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    7048 (TGFBR2)
   05212 Pancreatic cancer
    7048 (TGFBR2)
   05225 Hepatocellular carcinoma
    7048 (TGFBR2)
   05226 Gastric cancer
    7048 (TGFBR2)
   05220 Chronic myeloid leukemia
    7048 (TGFBR2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7048 (TGFBR2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7048 (TGFBR2)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    7048 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7048 (TGFBR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     7048 (TGFBR2)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   7048 (TGFBR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 7048
NCBI-ProteinID: NP_003233
OMIM: 190182
HGNC: 11773
Ensembl: ENSG00000163513
Vega: OTTHUMG00000130569
Pharos: P37173(Tchem)
UniProt: P37173 A3QNQ0
Structure
PDB: 

Position
3p24.1
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataacgacatgatagtcactgac
aacaacggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagttcaacc
tgggaaaccggcaagacgcggaagctcatggagttcagcgagcactgtgccatcatcctg
gaagatgaccgctctgacatcagctccacgtgtgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacagagaaggacatcttctcagacatcaatctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacaa
tactggctgatcaccgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccgggggattgctcac
ctccacagtgatcacactccatgtgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctaacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagtgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcatctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system