KEGG   Homo sapiens (human): 705Help
Entry
705               CDS       T01001                                 

Gene name
BYSL, BYSTIN, Enp1
Definition
(RefSeq) bystin like
  KO
K14797  essential nuclear protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    705 (BYSL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    705 (BYSL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bystin Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 705
NCBI-ProteinID: NP_004044
OMIM: 603871
HGNC: 1157
Ensembl: ENSG00000112578
Vega: OTTHUMG00000014687
Pharos: Q13895(Tbio)
UniProt: Q13895
Structure
PDB: 

Position
6p21.1
AA seq 437 aa AA seqDB search
MPKFKAARGVGGQEKHAPLADQILAGNAVRAGVREKRRGRGTGEAEEEYVGPRLSRRILQ
QARQQQEELEAEHGTGDKPAAPRERTTRLGPRMPQDGSDDEDEEWPTLEKAATMTAAGHH
AEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPMPQLDPR
VLEVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASN
LKERMAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTC
TLREAIIVGSIITKCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKYALPYRVLDAL
VFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRE
LQSAVPRDVEDVPITVE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaattcaaggcggcccgtggggtggggggtcaggaaaaacatgcgcccctggcc
gatcagatcctggctgggaatgcggtgcgggcgggggtccgggagaagcggcggggtcgc
gggacaggagaagcggaggaagagtatgtggggccccggctgagccgacggattttgcag
caagcacggcagcaacaggaggaactcgaggccgagcatgggactggggacaagcccgcg
gcgccgcgggaacgcaccacgcggctgggtccaagaatgcctcaggatggatcagatgac
gaggacgaggagtggcccaccctggagaaggctgccacaatgacagcagcgggccatcat
gcagaggtggttgtggaccctgaggatgagcgtgccatagagatgttcatgaacaagaac
cctcctgccaggcgcaccctggctgacatcatcatggagaagctgactgagaagcagaca
gaggttgagacagtcatgtcagaggtgtcgggcttccctatgccccagctggacccccgg
gtcctagaagtgtacaggggggtccgggaggtattatctaagtaccgcagtggaaaactg
cccaaggcatttaagatcatccctgcactctccaactgggagcaaatcctctacgtcaca
gagccggaggcctggactgcagctgccatgtaccaggccaccaggatttttgcctctaac
ctgaaggaacgcatggcccagcgcttctacaaccttgtcctgctccctcgagtacgagat
gacgttgctgaatacaaacgactcaacttccatctctacatggctctcaagaaggccctt
ttcaaacctggagcctggttcaaagggatcctgattccactgtgcgagtctggcacttgt
accctccgggaagccatcattgtgggtagcatcatcaccaagtgctccatccctgtgttg
cactccagtgcggccatgctgaaaattgctgagatggaatacagcggtgccaacagcatc
ttcctgcgactgctgctggataagaagtatgcactgccttaccgggtgctggatgcccta
gtcttccacttcctggggttccggacagagaagcgtgaactgcctgtgctgtggcaccag
tgcctcctgactttggtccagcgctacaaggccgacttggccacagaccagaaagaggcc
ctcttagaactgctccggctgcagccccatccacagctatcgcccgaaatcaggcgtgag
cttcagagtgcagtcccccgcgatgtggaagatgttcccatcaccgtggagtga

DBGET integrated database retrieval system