KEGG   Homo sapiens (human): 7052Help
Entry
7052              CDS       T01001                                 

Gene name
TGM2, TG(C), TGC
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    7052 (TGM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     7052 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core MG2
Motif
Other DBs
NCBI-GeneID: 7052
NCBI-ProteinID: NP_001310245
OMIM: 190196
HGNC: 11778
Ensembl: ENSG00000198959
Vega: OTTHUMG00000032437
Pharos: P21980(Tchem)
UniProt: P21980 V9HWG3
Structure
PDB: 

Position
20q11.23
AA seq 687 aa AA seqDB search
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctggtcttagagaggtgtgatctggagctggagaccaatggccgagac
caccacacggccgacctgtgccgggagaagctggtggtgcgacggggccagcccttctgg
ctgaccctgcactttgagggccgcaactacgaggccagtgtagacagtctcaccttcagt
gtcgtgaccggcccagcccctagccaggaggccgggaccaaggcccgttttccactaaga
gatgctgtggaggagggtgactggacagccaccgtggtggaccagcaagactgcaccctc
tcgctgcagctcaccaccccggccaacgcccccatcggcctgtatcgcctcagcctggag
gcctccactggctaccagggatccagctttgtgctgggccacttcattttgctcttcaac
gcctggtgcccagcggatgctgtgtacctggactcggaagaggagcggcaggagtatgtc
ctcacccagcagggctttatctaccagggctcggccaagttcatcaagaacataccttgg
aattttgggcagtttgaagatgggatcctagacatctgcctgatccttctagatgtcaac
cccaagttcctgaagaacgccggccgtgactgctcccgccgcagcagccccgtctacgtg
ggccgggtggtgagtggcatggtcaactgcaacgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggcgtcagccccatgtcctggatcggcagcgtggacatc
ctgcggcgctggaagaaccacggctgccagcgcgtcaagtatggccagtgctgggtcttc
gccgccgtggcctgcacagtgctgaggtgcctgggcatccctacccgcgtcgtgaccaac
tacaactcggcccatgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccggacctgcagccggggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacgtactgctgtggcccagttccagttcgtgccatcaag
gagggcgacctgagcaccaagtacgatgcgccctttgtctttgcggaggtcaatgccgac
gtggtagactggatccagcaggacgatgggtctgtgcacaaatccatcaaccgttccctg
atcgttgggctgaagatcagcactaagagcgtgggccgagacgagcgggaggatatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaagggcgaac
cacctgaacaaactggccgagaaggaggagacagggatggccatgcggatccgtgtgggc
cagagcatgaacatgggcagtgactttgacgtctttgcccacatcaccaacaacaccgct
gaggagtacgtctgccgcctcctgctctgtgcccgcaccgtcagctacaatgggatcttg
gggcccgagtgtggcaccaagtacctgctcaacctcaacctggagcctttctctgagaag
agcgttcctctttgcatcctctatgagaaataccgtgactgccttacggagtccaacctc
atcaaggtgcgggccctcctcgtggagccagttatcaacagctacctgctggctgagagg
gacctctacctggagaatccagaaatcaagatccggatccttggggagcccaagcagaaa
cgcaagctggtggctgaggtgtccctgcagaacccgctccctgtggccctggaaggctgc
accttcactgtggagggggccggcctgactgaggagcagaagacggtggagatcccagac
cccgtggaggcaggggaggaagttaaggtgagaatggacctgctgccgctccacatgggc
ctccacaagctggtggtgaacttcgagagcgacaagctgaaggctgtgaagggcttccgg
aatgtcatcattggccccgcctaa

DBGET integrated database retrieval system