KEGG   Homo sapiens (human): 7054Help
Entry
7054              CDS       T01001                                 

Gene name
TH, DYT14, DYT5b, TYH
Definition
(RefSeq) tyrosine hydroxylase
  KO
K00501  tyrosine 3-monooxygenase [EC:1.14.16.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
hsa04728  Dopaminergic synapse
hsa04917  Prolactin signaling pathway
hsa05012  Parkinson's disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Module
hsa_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Disease
H00831  Primary dystonia
Drug target
Metirosine: D00762
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    7054 (TH)
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    7054 (TH)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    7054 (TH)
  Nervous system
   04728 Dopaminergic synapse
    7054 (TH)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    7054 (TH)
  Substance dependence
   05030 Cocaine addiction
    7054 (TH)
   05031 Amphetamine addiction
    7054 (TH)
   05034 Alcoholism
    7054 (TH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.2  tyrosine 3-monooxygenase
     7054 (TH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H TOH_N Pollen_allerg_2
Motif
Other DBs
NCBI-GeneID: 7054
NCBI-ProteinID: NP_954986
OMIM: 191290
HGNC: 11782
Ensembl: ENSG00000180176
Vega: OTTHUMG00000009559
Pharos: P07101(Tclin)
UniProt: P07101 P78428
Structure
PDB: 

Position
11p15.5
AA seq 528 aa AA seqDB search
MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP
RSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR
ATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR
QVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI
AFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI
PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC
HELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG
AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS
RIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcccacccccgacgccaccacgccacaggccaagggcttccgcagggccgtgtctgag
ctggacgccaagcaggcagaggccatcatggtaagagggcagggcgccccggggcccagc
ctcacaggctctccgtggcctggaactgcagccccagctgcatcctacacccccacccca
aggtccccgcggttcattgggcgcaggcagagcctcatcgaggacgcccgcaaggagcgg
gaggcggcggtggcagcagcggccgctgcagtcccctcggagcccggggaccccctggag
gctgtggcctttgaggagaaggaggggaaggccgtgctaaacctgctcttctccccgagg
gccaccaagccctcggcgctgtcccgagctgtgaaggtgtttgagacgtttgaagccaaa
atccaccatctagagacccggcccgcccagaggccgcgagctgggggcccccacctggag
tacttcgtgcgcctcgaggtgcgccgaggggacctggccgccctgctcagtggtgtgcgc
caggtgtcagaggacgtgcgcagccccgcggggcccaaggtcccctggttcccaagaaaa
gtgtcagagctggacaagtgtcatcacctggtcaccaagttcgaccctgacctggacttg
gaccacccgggcttctcggaccaggtgtaccgccagcgcaggaagctgattgctgagatc
gccttccagtacaggcacggcgacccgattccccgtgtggagtacaccgccgaggagatt
gccacctggaaggaggtctacaccacgctgaagggcctctacgccacgcacgcctgcggg
gagcacctggaggcctttgctttgctggagcgcttcagcggctaccgggaagacaatatc
ccccagctggaggacgtctcccgcttcctgaaggagcgcacgggcttccagctgcggcct
gtggccggcctgctgtccgcccgggacttcctggccagcctggccttccgcgtgttccag
tgcacccagtatatccgccacgcgtcctcgcccatgcactcccctgagccggactgctgc
cacgagctgctggggcacgtgcccatgctggccgaccgcaccttcgcgcagttctcgcag
gacattggcctggcgtccctgggggcctcggatgaggaaattgagaagctgtccacgctg
tactggttcacggtggagttcgggctgtgtaagcagaacggggaggtgaaggcctatggt
gccgggctgctgtcctcctacggggagctcctgcactgcctgtctgaggagcctgagatt
cgggccttcgaccctgaggctgcggccgtgcagccctaccaagaccagacgtaccagtca
gtctacttcgtgtctgagagcttcagtgacgccaaggacaagctcaggagctatgcctca
cgcatccagcgccccttctccgtgaagttcgacccgtacacgctggccatcgacgtgctg
gacagcccccaggccgtgcggcgctccctggagggtgtccaggatgagctggacaccctt
gcccatgcgctgagtgccattggctag

DBGET integrated database retrieval system