KEGG   Homo sapiens (human): 7057Help
Entry
7057              CDS       T01001                                 

Gene name
THBS1, THBS, THBS-1, TSP, TSP-1, TSP1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04115  p53 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    7057 (THBS1)
   04350 TGF-beta signaling pathway
    7057 (THBS1)
   04151 PI3K-Akt signaling pathway
    7057 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7057 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7057 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    7057 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7057 (THBS1)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    7057 (THBS1)
   05205 Proteoglycans in cancer
    7057 (THBS1)
  09162 Cancers: Specific types
   05219 Bladder cancer
    7057 (THBS1)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    7057 (THBS1)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    7057 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7057 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7057 (THBS1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7057 (THBS1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7057 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA Laminin_G_3 cEGF Laminin_G_2 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 7057
NCBI-ProteinID: NP_003237
OMIM: 188060
HGNC: 11785
Ensembl: ENSG00000137801
Vega: OTTHUMG00000133665
Pharos: P07996(Tbio)
UniProt: P07996
Structure
PDB: 

Position
15q14
AA seq 1170 aa AA seqDB search
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcgtcctgttcctgatgcatgtgtgtggcaccaaccgc
attccagagtctggcggagacaacagcgtgtttgacatctttgaactcaccggggccgcc
cgcaaggggtctgggcgccgactggtgaagggccccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gctgtgcgggcagaaaagggtttcctccttctggcatccctgaggcagatgaagaagacc
cggggcacgctgctggccctggagcggaaagaccactctggccaggtcttcagcgtggtg
tccaatggcaaggcgggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtg
gtgtctgtggaagaagctctcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgactgtgaaaagatggagaatgctgagttggac
gtccccatccaaagcgtcttcaccagagacctggccagcatcgccagactccgcatcgca
aaggggggcgtcaatgacaatttccagggggtgctgcagaatgtgaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtcctcctc
acccttgacaacaacgtggtgaatggttccagccctgccatccgcactaactacattggc
cacaagacaaaggacttgcaagccatctgcggcatctcctgtgatgagctgtccagcatg
gtcctggaactcaggggcctgcgcaccattgtgaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagttggccaatgagctgaggcggcctcccctatgctatcac
aacggagttcagtacagaaataacgaggaatggactgttgatagctgcactgagtgtcac
tgtcagaactcagttaccatctgcaaaaaggtgtcctgccccatcatgccctgctccaat
gccacagttcctgatggagaatgctgtcctcgctgttggcccagcgactctgcggacgat
ggctggtctccatggtccgagtggacctcctgttctacgagctgtggcaatggaattcag
cagcgcggccgctcctgcgatagcctcaacaaccgatgtgagggctcctcggtccagaca
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggtggctggagccac
tggtccccgtggtcatcttgttctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaacgggaaaccctgtgaaggcgaagcgcgggag
accaaagcctgcaagaaagacgcctgccccatcaatggaggctggggtccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagtcgtctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtaacagaaaaccagatc
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgccggcgtg
aagtgtactagctaccctgatggcagctggaaatgtggtgcttgtccccctggttacagt
ggaaatggcatccagtgcacagatgttgatgagtgcaaagaagtgcctgatgcctgcttc
aaccacaatggagagcaccggtgtgagaacacggaccccggctacaactgcctgccctgc
cccccacgcttcaccggctcacagcccttcggccagggtgtcgaacatgccacggccaac
aaacaggtgtgcaagccccgtaacccctgcacggatgggacccacgactgcaacaagaac
gccaagtgcaactacctgggccactatagcgaccccatgtaccgctgcgagtgcaagcct
ggctacgctggcaatggcatcatctgcggggaggacacagacctggatggctggcccaat
gagaacctggtgtgcgtggccaatgcgacttaccactgcaaaaaggataattgccccaac
cttcccaactcagggcaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gacgatgacaatgataaaattccagatgacagggacaactgtccattccattacaaccca
gctcagtatgactatgacagagatgatgtgggagaccgctgtgacaactgtccctacaac
cacaacccagatcaggcagacacagacaacaatggggaaggagacgcctgtgctgcagac
attgatggagacggtatcctcaatgaacgggacaactgccagtacgtctacaatgtggac
cagagagacactgatatggatggggttggagatcagtgtgacaattgccccttggaacac
aatccggatcagctggactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaatctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaac
gatggcattcctgatgacaaggacaactgcagactcgtgcccaatcccgaccagaaggac
tctgacggcgatggtcgaggtgatgcctgcaaagatgattttgaccatgacagtgtgcca
gacatcgatgacatctgtcctgagaatgttgacatcagtgagaccgatttccgccgattc
cagatgattcctctggaccccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggactcgctgtaggttat
gatgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgaaagggacgat
gactatgctggatttgtctttggctaccagtccagcagccgcttttatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagggctcagggatactcgggc
ctttctgtgaaagttgtaaactccaccacagggcctggcgagcacctgcggaacgccctg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctcagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgat
aaaacctatgctggtggtagactagggttgtttgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgtagagatccctaa

DBGET integrated database retrieval system