KEGG   Homo sapiens (human): 7058Help
Entry
7058              CDS       T01001                                 

Gene name
THBS2, TSP2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7058 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7058 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    7058 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    7058 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    7058 (THBS2)
   05144 Malaria
    7058 (THBS2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7058 (THBS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7058 (THBS2)
  Exosomal proteins of colorectal cancer cells
   7058 (THBS2)
  Exosomal proteins of bladder cancer cells
   7058 (THBS2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   7058 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA EGF cEGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 7058
NCBI-ProteinID: NP_003238
OMIM: 188061
HGNC: 11786
Ensembl: ENSG00000186340
Vega: OTTHUMG00000045408
Pharos: P35442(Tbio)
UniProt: P35442
Structure
PDB: 

Position
6q27
AA seq 1172 aa AA seqDB search
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaggctggtcctgctggctctgtgggtgtggcccagcacgcaagctggtcac
caggacaaagacacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttt
gactacatcccaccggtgaacgcagatgacctcagcaagatcaccaagatcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ttggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaacggcccc
gcggacacgctggatctcacctactggattgacggcacccggcatgtggtctccctggag
gacgtcggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggcgagacc
tacagcttgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctctgccagagagagt
cacttcaggggtttgcttcagaacgtccacctagtgtttgaaaactctgtggaagatatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acagagacgctgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcccgaggtgtgcgaacgctcgtgcgaggagctgggaaacatggtccaggagctc
tcggggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaatgat
aaccagtttctctgggagctcattggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgaaacgtgggtggtggacagctgcaccacg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcctgcaacctgc
gccagtccatcctttgtggaaggcgaatgctgcccttcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggacccagtgctccgtgacgtgtggctctggg
acccagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagtctgagcaagtgtgacacccgcatccggcaggacggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagttggcaatatcacacgc
atccgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggc
cgggagaccaaagcctgccagggcgccccatgcccaatcgatggccgctggagcccctgg
tccccgtggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggatgtgcaggagcgt
cagatgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctgcttcccg
ggagcccagtgcagcagcttccccgatgggtcctggtcatgcggctcctgccctgtgggc
ttcttgggcaatggcacccactgtgaggacctggacgagtgtgccctggtccccgacatc
tgcttctccaccagcaaggtgcctcgctgtgtcaacactcagcctggcttccactgcctg
ccctgcccgccccgatacagagggaaccagcccgtcggggtcggcctggaagcagccaag
acggaaaagcaagtgtgtgagcccgaaaacccatgcaaggacaagacacacaactgccac
aagcacgcggagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgc
cagacaggctacgcgggcgacgggctcatctgcggggaggactcggacctggacggctgg
cccaacctcaatctggtctgcgccaccaacgccacctaccactgcatcaaggataactgc
ccccatctgccaaattctgggcaggaagactttgacaaggacgggattggcgatgcctgt
gatgatgacgatgacaatgacggtgtgaccgatgagaaggacaactgccagctcctcttc
aatccccgccaggctgactatgacaaggatgaggttggggaccgctgtgacaactgccct
tacgtgcacaaccctgcccagatcgacacagacaacaatggagagggtgacgcctgctcc
gtggacattgatggggacgatgtcttcaatgaacgagacaattgtccctacgtctacaac
actgaccagagggacacggatggtgacggtgtgggggatcactgtgacaactgccccctg
gtgcacaaccctgaccagaccgacgtggacaatgaccttgttggggaccagtgtgacaac
aacgaggacatagatgacgacggccaccagaacaaccaggacaactgcccctacatctcc
aacgccaaccaggctgaccatgacagagacggccagggcgacgcctgtgaccctgatgat
gacaacgatggcgtccccgatgacagggacaactgccggcttgtgttcaacccagaccag
gaggacttggacggtgatggacggggtgatatttgtaaagatgattttgacaatgacaac
atcccagatattgatgatgtgtgtcctgaaaacaatgccatcagtgagacagacttcagg
aacttccagatggtccccttggatcccaaagggaccacccaaattgatcccaactgggtc
attcgccatcaaggcaaggagctggttcagacagccaactcggaccccggcatcgctgta
ggttttgacgagtttgggtctgtggacttcagtggcacattctacgtaaacactgaccgg
gacgacgactatgccggcttcgtctttggttaccagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacgcagacctactgggaggaccagcccacgcgggcctatggctac
tccggcgtgtccctcaaggtggtgaactccaccacggggacgggcgagcacctgaggaac
gcgctgtggcacacggggaacacgccggggcaggtgcgaaccttatggcacgaccccagg
aacattggctggaaggactacacggcctataggtggcacctgactcacaggcccaagact
ggctacatcagagtcttagtgcatgaaggaaaacaggtcatggcagactcaggacctatc
tatgaccaaacctacgctggcgggcggctgggtctatttgtcttctctcaagaaatggtc
tatttctcagacctcaagtacgaatgcagagatatttaa

DBGET integrated database retrieval system