KEGG   Homo sapiens (human): 706Help
Entry
706               CDS       T01001                                 

Gene name
TSPO, BPBS, BZRP, DBI, IBP, MBR, PBR, PBS, PKBS, PTBR, mDRC, pk18
Definition
(RefSeq) translocator protein
  KO
K05770  translocator protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04979  Cholesterol metabolism
hsa05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    706 (TSPO)
 Organismal Systems
  Digestive system
   04979 Cholesterol metabolism
    706 (TSPO)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    706 (TSPO)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   706 (TSPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TspO_MBR
Motif
Other DBs
NCBI-GeneID: 706
NCBI-ProteinID: NP_000705
OMIM: 109610
HGNC: 1158
Ensembl: ENSG00000100300
Vega: OTTHUMG00000150573
Pharos: P30536(Tchem)
UniProt: P30536 O76068
Position
22q13.2
AA seq 169 aa AA seqDB search
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccccgccctgggtgcccgccatgggcttcacgctggcgcccagcctggggtgcttc
gtgggctcccgctttgtccacggcgagggtctccgctggtacgccggcctgcagaagccc
tcgtggcacccgccccactgggtgctgggccctgtctggggcacgctctactcagccatg
gggtacggctcctacctggtctggaaagagctgggaggcttcacagagaaggctgtggtt
cccctgggcctctacactgggcagctggccctgaactgggcatggccccccatcttcttt
ggtgcccgacaaatgggctgggccttggtggatctcctgctggtcagtggggcggcggca
gccactaccgtggcctggtaccaggtgagcccgctggccgcccgcctgctctacccctac
ctggcctggctggccttcacgaccacactcaactactgcgtatggcgggacaaccatggc
tggcgtgggggacggcggctgccagagtga

DBGET integrated database retrieval system