KEGG   Homo sapiens (human): 706Help
Entry
706               CDS       T01001                                 

Gene name
TSPO, BPBS, BZRP, DBI, IBP, MBR, PBR, PBS, PKBS, PTBR, mDRC, pk18
Definition
(RefSeq) translocator protein
  KO
K05770  translocator protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04979  Cholesterol metabolism
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    706 (TSPO)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    706 (TSPO)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    706 (TSPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    706 (TSPO)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   706 (TSPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TspO_MBR
Motif
Other DBs
NCBI-GeneID: 706
NCBI-ProteinID: NP_000705
OMIM: 109610
HGNC: 1158
Ensembl: ENSG00000100300
Vega: OTTHUMG00000150573
Pharos: P30536(Tchem)
UniProt: P30536 O76068
Position
22q13.2
AA seq 169 aa AA seqDB search
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccccgccctgggtgcccgccatgggcttcacgctggcgcccagcctggggtgcttc
gtgggctcccgctttgtccacggcgagggtctccgctggtacgccggcctgcagaagccc
tcgtggcacccgccccactgggtgctgggccctgtctggggcacgctctactcagccatg
gggtacggctcctacctggtctggaaagagctgggaggcttcacagagaaggctgtggtt
cccctgggcctctacactgggcagctggccctgaactgggcatggccccccatcttcttt
ggtgcccgacaaatgggctgggccttggtggatctcctgctggtcagtggggcggcggca
gccactaccgtggcctggtaccaggtgagcccgctggccgcccgcctgctctacccctac
ctggcctggctggccttcacgaccacactcaactactgcgtatggcgggacaaccatggc
tggcgtgggggacggcggctgccagagtga

DBGET integrated database retrieval system